Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (18 Sep 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium homeostasis modulator protein 2

Gene

CALHM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Pore-forming subunit of a voltage-gated ion channel.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel
Biological processIon transport, Transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.84.1.2 the calcium homeostasis modulator ca(2+) channel (calhm-c) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium homeostasis modulator protein 2
Alternative name(s):
Protein FAM26B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CALHM2
Synonyms:FAM26B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23493 CALHM2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612235 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HA72

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei21 – 41HelicalSequence analysisAdd BLAST21
Transmembranei55 – 75HelicalSequence analysisAdd BLAST21
Transmembranei100 – 120HelicalSequence analysisAdd BLAST21
Transmembranei185 – 205HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000138172

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162380963

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HA72

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CALHM2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
67461081

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001867201 – 323Calcium homeostasis modulator protein 2Add BLAST323

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HA72

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HA72

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HA72

PeptideAtlas

More...
PeptideAtlasi
Q9HA72

PRoteomics IDEntifications database

More...
PRIDEi
Q9HA72

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81380 [Q9HA72-1]
81381 [Q9HA72-2]
81382 [Q9HA72-3]

PTM databases

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9HA72

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138172 Expressed in 212 organ(s), highest expression level in right ovary

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HA72 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA014706

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000260743

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HA72

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CALHM family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ7Y Eukaryota
ENOG410XQ8H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182776

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294134

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HA72

KEGG Orthology (KO)

More...
KOi
K19739

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECQYRRT

Database of Orthologous Groups

More...
OrthoDBi
833717at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HA72

TreeFam database of animal gene trees

More...
TreeFami
TF329085

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029569 CALHM
IPR029570 CALHM2

The PANTHER Classification System

More...
PANTHERi
PTHR32261 PTHR32261, 1 hit
PTHR32261:SF3 PTHR32261:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14798 Ca_hom_mod, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9HA72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALIAENFR FLSLFFKSKD VMIFNGLVAL GTVGSQELFS VVAFHCPCSP
60 70 80 90 100
ARNYLYGLAA IGVPALVLFI IGIILNNHTW NLVAECQHRR TKNCSAAPTF
110 120 130 140 150
LLLSSILGRA AVAPVTWSVI SLLRGEAYVC ALSEFVDPSS LTAREEHFPS
160 170 180 190 200
AHATEILARF PCKENPDNLS DFREEVSRRL RYESQLFGWL LIGVVAILVF
210 220 230 240 250
LTKCLKHYCS PLSYRQEAYW AQYRANEDQL FQRTAEVHSR VLAANNVRRF
260 270 280 290 300
FGFVALNKDD EELIANFPVE GTQPRPQWNA ITGVYLYREN QGLPLYSRLH
310 320
KWAQGLAGNG AAPDNVEMAL LPS
Length:323
Mass (Da):36,175
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i20A4BC58F6763926
GO
Isoform 2 (identifier: Q9HA72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-218: LFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEA → VRSCAKGSSSSLVVAGERSGDGLVLKLGLVLRG
     219-323: Missing.

Note: No experimental confirmation available.
Show »
Length:218
Mass (Da):23,718
Checksum:i569EBDD40662D5D5
GO
Isoform 3 (identifier: Q9HA72-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     181-196: RYESQLFGWLLIGVVA → SSLDGCSSAWWPSWCS
     197-323: Missing.

Note: No experimental confirmation available.
Show »
Length:196
Mass (Da):21,542
Checksum:i1523996B86D6DA74
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053084136V → G. Corresponds to variant dbSNP:rs2232660Ensembl.1
Natural variantiVAR_033924194V → M. Corresponds to variant dbSNP:rs2232662Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013856181 – 196RYESQ…IGVVA → SSLDGCSSAWWPSWCS in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_013853186 – 218LFGWL…YRQEA → VRSCAKGSSSSLVVAGERSG DGLVLKLGLVLRG in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_013855197 – 323Missing in isoform 3. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_013854219 – 323Missing in isoform 2. 1 PublicationAdd BLAST105

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022195 mRNA Translation: BAB13983.1
AK125276 mRNA No translation available.
AF131810 mRNA Translation: AAD20050.1
AL139339 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49634.1
CH471066 Genomic DNA Translation: EAW49635.1
CH471066 Genomic DNA Translation: EAW49636.1
CH471066 Genomic DNA Translation: EAW49637.1
CH471066 Genomic DNA Translation: EAW49638.1
BC000039 mRNA Translation: AAH00039.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7549.1 [Q9HA72-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057000.2, NM_015916.4 [Q9HA72-1]
XP_006717943.1, XM_006717880.2 [Q9HA72-1]
XP_006717946.1, XM_006717883.2 [Q9HA72-1]
XP_006717947.1, XM_006717884.3 [Q9HA72-3]
XP_011538150.1, XM_011539848.2 [Q9HA72-1]
XP_016871795.1, XM_017016306.1 [Q9HA72-1]
XP_016871796.1, XM_017016307.1 [Q9HA72-1]
XP_016871797.1, XM_017016308.1 [Q9HA72-3]
XP_016871798.1, XM_017016309.1 [Q9HA72-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000260743; ENSP00000260743; ENSG00000138172 [Q9HA72-1]
ENST00000369788; ENSP00000358803; ENSG00000138172 [Q9HA72-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51063

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51063

UCSC genome browser

More...
UCSCi
uc001kxa.4 human [Q9HA72-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022195 mRNA Translation: BAB13983.1
AK125276 mRNA No translation available.
AF131810 mRNA Translation: AAD20050.1
AL139339 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49634.1
CH471066 Genomic DNA Translation: EAW49635.1
CH471066 Genomic DNA Translation: EAW49636.1
CH471066 Genomic DNA Translation: EAW49637.1
CH471066 Genomic DNA Translation: EAW49638.1
BC000039 mRNA Translation: AAH00039.1
CCDSiCCDS7549.1 [Q9HA72-1]
RefSeqiNP_057000.2, NM_015916.4 [Q9HA72-1]
XP_006717943.1, XM_006717880.2 [Q9HA72-1]
XP_006717946.1, XM_006717883.2 [Q9HA72-1]
XP_006717947.1, XM_006717884.3 [Q9HA72-3]
XP_011538150.1, XM_011539848.2 [Q9HA72-1]
XP_016871795.1, XM_017016306.1 [Q9HA72-1]
XP_016871796.1, XM_017016307.1 [Q9HA72-1]
XP_016871797.1, XM_017016308.1 [Q9HA72-3]
XP_016871798.1, XM_017016309.1 [Q9HA72-3]

3D structure databases

SMRiQ9HA72
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000260743

Protein family/group databases

TCDBi1.A.84.1.2 the calcium homeostasis modulator ca(2+) channel (calhm-c) family

PTM databases

SwissPalmiQ9HA72

Polymorphism and mutation databases

BioMutaiCALHM2
DMDMi67461081

Proteomic databases

jPOSTiQ9HA72
MassIVEiQ9HA72
PaxDbiQ9HA72
PeptideAtlasiQ9HA72
PRIDEiQ9HA72
ProteomicsDBi81380 [Q9HA72-1]
81381 [Q9HA72-2]
81382 [Q9HA72-3]

Genome annotation databases

EnsembliENST00000260743; ENSP00000260743; ENSG00000138172 [Q9HA72-1]
ENST00000369788; ENSP00000358803; ENSG00000138172 [Q9HA72-1]
GeneIDi51063
KEGGihsa:51063
UCSCiuc001kxa.4 human [Q9HA72-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51063

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CALHM2
HGNCiHGNC:23493 CALHM2
HPAiHPA014706
MIMi612235 gene
neXtProtiNX_Q9HA72
OpenTargetsiENSG00000138172
PharmGKBiPA162380963

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJ7Y Eukaryota
ENOG410XQ8H LUCA
GeneTreeiENSGT00950000182776
HOGENOMiHOG000294134
InParanoidiQ9HA72
KOiK19739
OMAiECQYRRT
OrthoDBi833717at2759
PhylomeDBiQ9HA72
TreeFamiTF329085

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CALHM2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51063
PharosiQ9HA72

Protein Ontology

More...
PROi
PR:Q9HA72

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138172 Expressed in 212 organ(s), highest expression level in right ovary
GenevisibleiQ9HA72 HS

Family and domain databases

InterProiView protein in InterPro
IPR029569 CALHM
IPR029570 CALHM2
PANTHERiPTHR32261 PTHR32261, 1 hit
PTHR32261:SF3 PTHR32261:SF3, 1 hit
PfamiView protein in Pfam
PF14798 Ca_hom_mod, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAHM2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HA72
Secondary accession number(s): D3DR94, O95893, Q6ZUV9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: March 1, 2001
Last modified: September 18, 2019
This is version 130 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again