Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uridine-cytidine kinase 1

Gene

UCK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N4-acetylcytidine, N4-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N4-anisoylcytidine.

Catalytic activityi

ATP + uridine = ADP + UMP.
ATP + cytidine = ADP + CMP.

Pathwayi: CTP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes CTP from cytidine.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. Uridine-cytidine kinase-like 1 (UCKL1), Uridine-cytidine kinase 2 (UCK2), Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase, Uridine-cytidine kinase (UCK2), Uridine-cytidine kinase (UCK1)
  2. no protein annotated in this organism
  3. no protein annotated in this organism
This subpathway is part of the pathway CTP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CTP from cytidine, the pathway CTP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Pathwayi: UMP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes UMP from uridine.
Proteins known to be involved in this subpathway in this organism are:
  1. Uridine-cytidine kinase-like 1 (UCKL1), Uridine-cytidine kinase 2 (UCK2), Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase, Uridine-cytidine kinase (UCK2), Uridine-cytidine kinase (UCK1)
This subpathway is part of the pathway UMP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes UMP from uridine, the pathway UMP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei87SubstrateBy similarity1
Binding sitei115SubstrateBy similarity1
Binding sitei120SubstrateBy similarity1
Binding sitei169SubstrateBy similarity1
Binding sitei178SubstrateBy similarity1
Binding sitei186SubstrateBy similarity1
Binding sitei215ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi30 – 38ATP9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • nucleoside kinase activity Source: Reactome
  • uridine kinase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS05429-MONOMER
BRENDAi2.7.1.48 2681
ReactomeiR-HSA-73614 Pyrimidine salvage
SABIO-RKiQ9HA47
UniPathwayi
UPA00574;UER00637

UPA00579;UER00640

Names & Taxonomyi

Protein namesi
Recommended name:
Uridine-cytidine kinase 1 (EC:2.7.1.48)
Short name:
UCK 1
Alternative name(s):
Cytidine monophosphokinase 1
Uridine monophosphokinase 1
Gene namesi
Name:UCK1
Synonyms:URK1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000130717.12
HGNCiHGNC:14859 UCK1
MIMi609328 gene
neXtProtiNX_Q9HA47

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi83549
OpenTargetsiENSG00000130717
PharmGKBiPA134861770

Chemistry databases

ChEMBLiCHEMBL5682

Polymorphism and mutation databases

BioMutaiUCK1
DMDMi20455360

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001644531 – 277Uridine-cytidine kinase 1Add BLAST277

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei251PhosphothreonineCombined sources1
Modified residuei253PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HA47
MaxQBiQ9HA47
PaxDbiQ9HA47
PeptideAtlasiQ9HA47
PRIDEiQ9HA47
ProteomicsDBi81375
81376 [Q9HA47-2]

PTM databases

iPTMnetiQ9HA47
PhosphoSitePlusiQ9HA47

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000130717 Expressed in 181 organ(s), highest expression level in cerebellum
CleanExiHS_UCK1
ExpressionAtlasiQ9HA47 baseline and differential
GenevisibleiQ9HA47 HS

Organism-specific databases

HPAiHPA050969

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
UCK1A0A0S2Z5Y63EBI-16434682,EBI-16434671

Protein-protein interaction databases

BioGridi123681, 7 interactors
IntActiQ9HA47, 3 interactors
STRINGi9606.ENSP00000361289

Structurei

Secondary structure

1277
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9HA47
SMRiQ9HA47
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HA47

Family & Domainsi

Sequence similaritiesi

Belongs to the uridine kinase family.Curated

Phylogenomic databases

eggNOGiENOG410IMEH Eukaryota
COG0572 LUCA
GeneTreeiENSGT00390000015696
HOGENOMiHOG000262756
HOVERGENiHBG023339
InParanoidiQ9HA47
KOiK00876
OMAiTTLKPMH
OrthoDBiEOG091G07OR
PhylomeDBiQ9HA47
TreeFamiTF316686

Family and domain databases

CDDicd02023 UMPK, 1 hit
InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR006083 PRK/URK
IPR029920 UCK-1
IPR000764 Uridine_kinase-like
PANTHERiPTHR10285:SF66 PTHR10285:SF66, 1 hit
PfamiView protein in Pfam
PF00485 PRK, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00235 udk, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HA47-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN
60 70 80 90 100
EVEQRQRKVV ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT
110 120 130 140 150
LKNIVEGKTV EVPTYDFVTH SRLPETTVVY PADVVLFEGI LVFYSQEIRD
160 170 180 190 200
MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL EQILTQYTTF VKPAFEEFCL
210 220 230 240 250
PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR GGSNGRSYKR
260 270
TFSEPGDHPG MLTSGKRSHL ESSSRPH
Length:277
Mass (Da):31,435
Last modified:March 1, 2001 - v1
Checksum:iAFD9ED92780CD502
GO
Isoform 2 (identifier: Q9HA47-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW

Show »
Length:201
Mass (Da):22,761
Checksum:i0E5F2F00FF6052D3
GO
Isoform 3 (identifier: Q9HA47-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: Missing.

Show »
Length:268
Mass (Da):30,690
Checksum:i3944B9DCF2A0BAE3
GO
Isoform 4 (identifier: Q9HA47-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: VSGGTASGK → DERFQAGIPLLCLQ

Show »
Length:282
Mass (Da):32,275
Checksum:i3A379F825B7EAC8A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V170G3V170_HUMAN
Uridine-cytidine kinase 1
UCK1 hCG_29237
218Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8 – 17DCESPAPEAD → GARARAGAN in AAL75943 (Ref. 3) Curated10
Sequence conflicti56 – 57QR → HG in AAL75943 (Ref. 3) Curated2
Sequence conflicti175R → H in CAG33562 (Ref. 5) Curated1
Sequence conflicti247S → T in AAL75943 (Ref. 3) Curated1
Isoform 2 (identifier: Q9HA47-2)
Sequence conflicti180A → T in AAH15547 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04517428 – 36Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_05674828 – 36VSGGTASGK → DERFQAGIPLLCLQ in isoform 4. Curated9
Alternative sequenceiVSP_041269170 – 277VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. 1 PublicationAdd BLAST108

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237290 mRNA Translation: AAK28324.1
AF254133 mRNA Translation: AAK49122.1
AF125106 mRNA Translation: AAL75943.1
AK022317 mRNA Translation: BAB14010.1
AK295471 mRNA Translation: BAG58400.1
CR457281 mRNA Translation: CAG33562.1
AL358781 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87983.1
BC015547 mRNA Translation: AAH15547.1
BC091495 mRNA Translation: AAH91495.1
CCDSiCCDS48046.1 [Q9HA47-2]
CCDS59151.1 [Q9HA47-3]
CCDS59152.1 [Q9HA47-4]
CCDS6944.1 [Q9HA47-1]
RefSeqiNP_001129426.1, NM_001135954.2 [Q9HA47-2]
NP_001248379.1, NM_001261450.2 [Q9HA47-3]
NP_001248380.1, NM_001261451.2 [Q9HA47-4]
NP_001305448.1, NM_001318519.1
NP_113620.1, NM_031432.3 [Q9HA47-1]
UniGeneiHs.9597

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717 [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717 [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717 [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717 [Q9HA47-1]
GeneIDi83549
KEGGihsa:83549
UCSCiuc004cay.4 human [Q9HA47-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237290 mRNA Translation: AAK28324.1
AF254133 mRNA Translation: AAK49122.1
AF125106 mRNA Translation: AAL75943.1
AK022317 mRNA Translation: BAB14010.1
AK295471 mRNA Translation: BAG58400.1
CR457281 mRNA Translation: CAG33562.1
AL358781 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87983.1
BC015547 mRNA Translation: AAH15547.1
BC091495 mRNA Translation: AAH91495.1
CCDSiCCDS48046.1 [Q9HA47-2]
CCDS59151.1 [Q9HA47-3]
CCDS59152.1 [Q9HA47-4]
CCDS6944.1 [Q9HA47-1]
RefSeqiNP_001129426.1, NM_001135954.2 [Q9HA47-2]
NP_001248379.1, NM_001261450.2 [Q9HA47-3]
NP_001248380.1, NM_001261451.2 [Q9HA47-4]
NP_001305448.1, NM_001318519.1
NP_113620.1, NM_031432.3 [Q9HA47-1]
UniGeneiHs.9597

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
ProteinModelPortaliQ9HA47
SMRiQ9HA47
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123681, 7 interactors
IntActiQ9HA47, 3 interactors
STRINGi9606.ENSP00000361289

Chemistry databases

ChEMBLiCHEMBL5682

PTM databases

iPTMnetiQ9HA47
PhosphoSitePlusiQ9HA47

Polymorphism and mutation databases

BioMutaiUCK1
DMDMi20455360

Proteomic databases

EPDiQ9HA47
MaxQBiQ9HA47
PaxDbiQ9HA47
PeptideAtlasiQ9HA47
PRIDEiQ9HA47
ProteomicsDBi81375
81376 [Q9HA47-2]

Protocols and materials databases

DNASUi83549
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717 [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717 [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717 [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717 [Q9HA47-1]
GeneIDi83549
KEGGihsa:83549
UCSCiuc004cay.4 human [Q9HA47-1]

Organism-specific databases

CTDi83549
DisGeNETi83549
EuPathDBiHostDB:ENSG00000130717.12
GeneCardsiUCK1
HGNCiHGNC:14859 UCK1
HPAiHPA050969
MIMi609328 gene
neXtProtiNX_Q9HA47
OpenTargetsiENSG00000130717
PharmGKBiPA134861770
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMEH Eukaryota
COG0572 LUCA
GeneTreeiENSGT00390000015696
HOGENOMiHOG000262756
HOVERGENiHBG023339
InParanoidiQ9HA47
KOiK00876
OMAiTTLKPMH
OrthoDBiEOG091G07OR
PhylomeDBiQ9HA47
TreeFamiTF316686

Enzyme and pathway databases

UniPathwayi
UPA00574;UER00637

UPA00579;UER00640

BioCyciMetaCyc:HS05429-MONOMER
BRENDAi2.7.1.48 2681
ReactomeiR-HSA-73614 Pyrimidine salvage
SABIO-RKiQ9HA47

Miscellaneous databases

ChiTaRSiUCK1 human
EvolutionaryTraceiQ9HA47
GenomeRNAii83549
PROiPR:Q9HA47
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130717 Expressed in 181 organ(s), highest expression level in cerebellum
CleanExiHS_UCK1
ExpressionAtlasiQ9HA47 baseline and differential
GenevisibleiQ9HA47 HS

Family and domain databases

CDDicd02023 UMPK, 1 hit
InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR006083 PRK/URK
IPR029920 UCK-1
IPR000764 Uridine_kinase-like
PANTHERiPTHR10285:SF66 PTHR10285:SF66, 1 hit
PfamiView protein in Pfam
PF00485 PRK, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00235 udk, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUCK1_HUMAN
AccessioniPrimary (citable) accession number: Q9HA47
Secondary accession number(s): Q5JT09
, Q5JT10, Q5JT12, Q5JT13, Q6IA74, Q96BJ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again