Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (17 Jun 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Uridine-cytidine kinase 1

Gene

UCK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N4-acetylcytidine, N4-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N4-anisoylcytidine.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: CTP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes CTP from cytidine.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase 2 (UCK2), Uridine-cytidine kinase (UCK1), Uridine-cytidine kinase-like 1 (UCKL1), Uridine-cytidine kinase
  2. no protein annotated in this organism
  3. no protein annotated in this organism
This subpathway is part of the pathway CTP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CTP from cytidine, the pathway CTP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Pathwayi: UMP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes UMP from uridine.
Proteins known to be involved in this subpathway in this organism are:
  1. Uridine-cytidine kinase 1 (UCK1), Uridine-cytidine kinase 2 (UCK2), Uridine-cytidine kinase (UCK1), Uridine-cytidine kinase-like 1 (UCKL1), Uridine-cytidine kinase
This subpathway is part of the pathway UMP biosynthesis via salvage pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes UMP from uridine, the pathway UMP biosynthesis via salvage pathway and in Pyrimidine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei87SubstrateBy similarity1
Binding sitei115SubstrateBy similarity1
Binding sitei120SubstrateBy similarity1
Binding sitei169SubstrateBy similarity1
Binding sitei178SubstrateBy similarity1
Binding sitei186SubstrateBy similarity1
Binding sitei215ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi30 – 38ATP9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS05429-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.48 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-73614 Pyrimidine salvage

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q9HA47

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00574;UER00637
UPA00579;UER00640

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uridine-cytidine kinase 1 (EC:2.7.1.48)
Short name:
UCK 1
Alternative name(s):
Cytidine monophosphokinase 1
Uridine monophosphokinase 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UCK1
Synonyms:URK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000130717.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14859 UCK1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609328 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HA47

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
83549

Open Targets

More...
OpenTargetsi
ENSG00000130717

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134861770

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HA47 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5682

DrugCentral

More...
DrugCentrali
Q9HA47

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UCK1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20455360

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001644531 – 277Uridine-cytidine kinase 1Add BLAST277

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei251PhosphothreonineCombined sources1
Modified residuei253PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HA47

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HA47

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HA47

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HA47

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HA47

PeptideAtlas

More...
PeptideAtlasi
Q9HA47

PRoteomics IDEntifications database

More...
PRIDEi
Q9HA47

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
63191
63192
81375 [Q9HA47-1]
81376 [Q9HA47-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HA47

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q9HA47

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HA47

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000130717 Expressed in cerebellum and 180 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HA47 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HA47 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000130717 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123681, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HA47, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361285

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9HA47 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1277
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HA47

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HA47

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the uridine kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMEH Eukaryota
COG0572 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182816

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021278_1_4_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HA47

KEGG Orthology (KO)

More...
KOi
K00876

Identification of Orthologs from Complete Genome Data

More...
OMAi
ILVFYNQ

Database of Orthologous Groups

More...
OrthoDBi
929897at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HA47

TreeFam database of animal gene trees

More...
TreeFami
TF316686

Family and domain databases

Conserved Domains Database

More...
CDDi
cd02023 UMPK, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027417 P-loop_NTPase
IPR006083 PRK/URK
IPR029920 UCK-1
IPR000764 Uridine_kinase-like

The PANTHER Classification System

More...
PANTHERi
PTHR10285:SF66 PTHR10285:SF66, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00485 PRK, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00235 udk, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HA47-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASAGGEDCE SPAPEADRPH QRPFLIGVSG GTASGKSTVC EKIMELLGQN
60 70 80 90 100
EVEQRQRKVV ILSQDRFYKV LTAEQKAKAL KGQYNFDHPD AFDNDLMHRT
110 120 130 140 150
LKNIVEGKTV EVPTYDFVTH SRLPETTVVY PADVVLFEGI LVFYSQEIRD
160 170 180 190 200
MFHLRLFVDT DSDVRLSRRV LRDVRRGRDL EQILTQYTTF VKPAFEEFCL
210 220 230 240 250
PTKKYADVII PRGVDNMVAI NLIVQHIQDI LNGDICKWHR GGSNGRSYKR
260 270
TFSEPGDHPG MLTSGKRSHL ESSSRPH
Length:277
Mass (Da):31,435
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAFD9ED92780CD502
GO
Isoform 2 (identifier: Q9HA47-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-277: VLRDVRRGRD...SHLESSSRPH → DKEVCRCDHPARSGQYGCHQPDRAAHPGHSEW

Show »
Length:201
Mass (Da):22,761
Checksum:i0E5F2F00FF6052D3
GO
Isoform 3 (identifier: Q9HA47-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: Missing.

Show »
Length:268
Mass (Da):30,690
Checksum:i3944B9DCF2A0BAE3
GO
Isoform 4 (identifier: Q9HA47-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-36: VSGGTASGK → DERFQAGIPLLCLQ

Show »
Length:282
Mass (Da):32,275
Checksum:i3A379F825B7EAC8A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V170G3V170_HUMAN
Uridine-cytidine kinase 1
UCK1 hCG_29237
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8 – 17DCESPAPEAD → GARARAGAN in AAL75943 (Ref. 3) Curated10
Sequence conflicti56 – 57QR → HG in AAL75943 (Ref. 3) Curated2
Sequence conflicti175R → H in CAG33562 (Ref. 5) Curated1
Sequence conflicti247S → T in AAL75943 (Ref. 3) Curated1
Isoform 2 (identifier: Q9HA47-2)
Sequence conflicti180A → T in AAH15547 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04517428 – 36Missing in isoform 3. 1 Publication9
Alternative sequenceiVSP_05674828 – 36VSGGTASGK → DERFQAGIPLLCLQ in isoform 4. Curated9
Alternative sequenceiVSP_041269170 – 277VLRDV…SSRPH → DKEVCRCDHPARSGQYGCHQ PDRAAHPGHSEW in isoform 2. 1 PublicationAdd BLAST108

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF237290 mRNA Translation: AAK28324.1
AF254133 mRNA Translation: AAK49122.1
AF125106 mRNA Translation: AAL75943.1
AK022317 mRNA Translation: BAB14010.1
AK295471 mRNA Translation: BAG58400.1
CR457281 mRNA Translation: CAG33562.1
AL358781 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87983.1
BC015547 mRNA Translation: AAH15547.1
BC091495 mRNA Translation: AAH91495.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48046.1 [Q9HA47-2]
CCDS59151.1 [Q9HA47-3]
CCDS59152.1 [Q9HA47-4]
CCDS6944.1 [Q9HA47-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129426.1, NM_001135954.2 [Q9HA47-2]
NP_001248379.1, NM_001261450.2 [Q9HA47-3]
NP_001248380.1, NM_001261451.2 [Q9HA47-4]
NP_001305448.1, NM_001318519.1
NP_113620.1, NM_031432.3 [Q9HA47-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372208; ENSP00000361282; ENSG00000130717 [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717 [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717 [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717 [Q9HA47-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83549

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83549

UCSC genome browser

More...
UCSCi
uc004cay.4 human [Q9HA47-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF237290 mRNA Translation: AAK28324.1
AF254133 mRNA Translation: AAK49122.1
AF125106 mRNA Translation: AAL75943.1
AK022317 mRNA Translation: BAB14010.1
AK295471 mRNA Translation: BAG58400.1
CR457281 mRNA Translation: CAG33562.1
AL358781 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87983.1
BC015547 mRNA Translation: AAH15547.1
BC091495 mRNA Translation: AAH91495.1
CCDSiCCDS48046.1 [Q9HA47-2]
CCDS59151.1 [Q9HA47-3]
CCDS59152.1 [Q9HA47-4]
CCDS6944.1 [Q9HA47-1]
RefSeqiNP_001129426.1, NM_001135954.2 [Q9HA47-2]
NP_001248379.1, NM_001261450.2 [Q9HA47-3]
NP_001248380.1, NM_001261451.2 [Q9HA47-4]
NP_001305448.1, NM_001318519.1
NP_113620.1, NM_031432.3 [Q9HA47-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JEOX-ray2.50A22-243[»]
2UVQX-ray3.00A22-243[»]
SMRiQ9HA47
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi123681, 7 interactors
IntActiQ9HA47, 7 interactors
STRINGi9606.ENSP00000361285

Chemistry databases

ChEMBLiCHEMBL5682
DrugCentraliQ9HA47

PTM databases

iPTMnetiQ9HA47
MetOSiteiQ9HA47
PhosphoSitePlusiQ9HA47

Polymorphism and mutation databases

BioMutaiUCK1
DMDMi20455360

Proteomic databases

EPDiQ9HA47
jPOSTiQ9HA47
MassIVEiQ9HA47
MaxQBiQ9HA47
PaxDbiQ9HA47
PeptideAtlasiQ9HA47
PRIDEiQ9HA47
ProteomicsDBi63191
63192
81375 [Q9HA47-1]
81376 [Q9HA47-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31627 304 antibodies

The DNASU plasmid repository

More...
DNASUi
83549

Genome annotation databases

EnsembliENST00000372208; ENSP00000361282; ENSG00000130717 [Q9HA47-2]
ENST00000372210; ENSP00000361284; ENSG00000130717 [Q9HA47-3]
ENST00000372211; ENSP00000361285; ENSG00000130717 [Q9HA47-4]
ENST00000372215; ENSP00000361289; ENSG00000130717 [Q9HA47-1]
GeneIDi83549
KEGGihsa:83549
UCSCiuc004cay.4 human [Q9HA47-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83549
DisGeNETi83549
EuPathDBiHostDB:ENSG00000130717.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UCK1
HGNCiHGNC:14859 UCK1
HPAiENSG00000130717 Low tissue specificity
MIMi609328 gene
neXtProtiNX_Q9HA47
OpenTargetsiENSG00000130717
PharmGKBiPA134861770

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMEH Eukaryota
COG0572 LUCA
GeneTreeiENSGT00950000182816
HOGENOMiCLU_021278_1_4_1
InParanoidiQ9HA47
KOiK00876
OMAiILVFYNQ
OrthoDBi929897at2759
PhylomeDBiQ9HA47
TreeFamiTF316686

Enzyme and pathway databases

UniPathwayiUPA00574;UER00637
UPA00579;UER00640
BioCyciMetaCyc:HS05429-MONOMER
BRENDAi2.7.1.48 2681
ReactomeiR-HSA-73614 Pyrimidine salvage
SABIO-RKiQ9HA47

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
83549 2 hits in 787 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UCK1 human
EvolutionaryTraceiQ9HA47

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83549
PharosiQ9HA47 Tbio

Protein Ontology

More...
PROi
PR:Q9HA47
RNActiQ9HA47 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000130717 Expressed in cerebellum and 180 other tissues
ExpressionAtlasiQ9HA47 baseline and differential
GenevisibleiQ9HA47 HS

Family and domain databases

CDDicd02023 UMPK, 1 hit
InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR006083 PRK/URK
IPR029920 UCK-1
IPR000764 Uridine_kinase-like
PANTHERiPTHR10285:SF66 PTHR10285:SF66, 1 hit
PfamiView protein in Pfam
PF00485 PRK, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00235 udk, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUCK1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HA47
Secondary accession number(s): Q5JT09
, Q5JT10, Q5JT12, Q5JT13, Q6IA74, Q96BJ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: June 17, 2020
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again