Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (26 Feb 2020)
Sequence version 2 (04 Apr 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

DNA-directed RNA polymerase I subunit RPA2

Gene

POLR1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri1070 – 1101C4-typeSequence analysisAdd BLAST32

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionNucleotidyltransferase, Transferase
Biological processTranscription
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-427413 NoRC negatively regulates rRNA expression
R-HSA-5250924 B-WICH complex positively regulates rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-73772 RNA Polymerase I Promoter Escape
R-HSA-73863 RNA Polymerase I Transcription Termination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA-directed RNA polymerase I subunit RPA2 (EC:2.7.7.6)
Short name:
RNA polymerase I subunit 2
Alternative name(s):
DNA-directed RNA polymerase I 135 kDa polypeptide
Short name:
RPA135
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:POLR1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20454 POLR1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602000 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H9Y6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

DNA-directed RNA polymerase, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000125630

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA130601182

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H9Y6 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
POLR1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
92090637

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000480721 – 1135DNA-directed RNA polymerase I subunit RPA2Add BLAST1135

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1051PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H9Y6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H9Y6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H9Y6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H9Y6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H9Y6

PeptideAtlas

More...
PeptideAtlasi
Q9H9Y6

PRoteomics IDEntifications database

More...
PRIDEi
Q9H9Y6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25159
30108
81369 [Q9H9Y6-1]
81370 [Q9H9Y6-2]

2D gel databases

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...
SWISS-2DPAGEi
Q9H9Y6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H9Y6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H9Y6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000125630 Expressed in buccal mucosa cell and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H9Y6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H9Y6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037528

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the RNA polymerase I (Pol I) complex consisting of at least 13 subunits.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
O956023EBI-355441,EBI-359472

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123926, 67 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H9Y6

Database of interacting proteins

More...
DIPi
DIP-27538N

Protein interaction database and analysis system

More...
IntActi
Q9H9Y6, 31 interactors

Molecular INTeraction database

More...
MINTi
Q9H9Y6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000444136

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H9Y6 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H9Y6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RNA polymerase beta chain family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1070 – 1101C4-typeSequence analysisAdd BLAST32

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0216 Eukaryota
COG0085 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183132

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000524_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H9Y6

KEGG Orthology (KO)

More...
KOi
K03002

Identification of Orthologs from Complete Genome Data

More...
OMAi
FFGVVHY

Database of Orthologous Groups

More...
OrthoDBi
42570at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H9Y6

TreeFam database of animal gene trees

More...
TreeFami
TF103055

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00653 RNA_pol_B_RPB2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.270.10, 1 hit
2.40.50.150, 1 hit
3.90.1110.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015712 DNA-dir_RNA_pol_su2
IPR007120 DNA-dir_RNAP_su2_dom
IPR037033 DNA-dir_RNAP_su2_hyb_sf
IPR007121 RNA_pol_bsu_CS
IPR007644 RNA_pol_bsu_protrusion
IPR007642 RNA_pol_Rpb2_2
IPR037034 RNA_pol_Rpb2_2_sf
IPR007645 RNA_pol_Rpb2_3
IPR007641 RNA_pol_Rpb2_7
IPR014724 RNA_pol_RPB2_OB-fold
IPR009674 Rpa2_dom_4

The PANTHER Classification System

More...
PANTHERi
PTHR20856 PTHR20856, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06883 RNA_pol_Rpa2_4, 1 hit
PF04563 RNA_pol_Rpb2_1, 1 hit
PF04561 RNA_pol_Rpb2_2, 1 hit
PF04565 RNA_pol_Rpb2_3, 1 hit
PF00562 RNA_pol_Rpb2_6, 1 hit
PF04560 RNA_pol_Rpb2_7, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01166 RNA_POL_BETA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H9Y6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDPGSRWRNL PSGPSLKHLT DPSYGIPREQ QKAALQELTR AHVESFNYAV
60 70 80 90 100
HEGLGLAVQA IPPFEFAFKD ERISFTILDA VISPPTVPKG TICKEANVYP
110 120 130 140 150
AECRGRRSTY RGKLTADINW AVNGISKGII KQFLGYVPIM VKSKLCNLRN
160 170 180 190 200
LPPQALIEHH EEAEEMGGYF IINGIEKVIR MLIMPRRNFP IAMIRPKWKT
210 220 230 240 250
RGPGYTQYGV SMHCVREEHS AVNMNLHYLE NGTVMLNFIY RKELFFLPLG
260 270 280 290 300
FALKALVSFS DYQIFQELIK GKEDDSFLRN SVSQMLRIVM EEGCSTQKQV
310 320 330 340 350
LNYLGECFRV KLNVPDWYPN EQAAEFLFNQ CICIHLKSNT EKFYMLCLMT
360 370 380 390 400
RKLFALAKGE CMEDNPDSLV NQEVLTPGQL FLMFLKEKLE GWLVSIKIAF
410 420 430 440 450
DKKAQKTSVS MNTDNLMRIF TMGIDLTKPF EYLFATGNLR SKTGLGLLQD
460 470 480 490 500
SGLCVVADKL NFIRYLSHFR CVHRGADFAK MRTTTVRRLL PESWGFLCPV
510 520 530 540 550
HTPDGEPCGL MNHLTAVCEV VTQFVYTASI PALLCNLGVT PIDGAPHRSY
560 570 580 590 600
SECYPVLLDG VMVGWVDKDL APGIADSLRH FKVLREKRIP PWMEVVLIPM
610 620 630 640 650
TGKPSLYPGL FLFTTPCRLV RPVQNLALGK EELIGTMEQI FMNVAIFEDE
660 670 680 690 700
VFAGVTTHQE LFPHSLLSVI ANFIPFSDHN QSPRNMYQCQ MGKQTMGFPL
710 720 730 740 750
LTYQDRSDNK LYRLQTPQSP LVRPSMYDYY DMDNYPIGTN AIVAVISYTG
760 770 780 790 800
YDMEDAMIVN KASWERGFAH GSVYKSEFID LSEKIKQGDS SLVFGIKPGD
810 820 830 840 850
PRVLQKLDDD GLPFIGAKLQ YGDPYYSYLN LNTGESFVMY YKSKENCVVD
860 870 880 890 900
NIKVCSNDTG SGKFKCVCIT MRVPRNPTIG DKFASRHGQK GILSRLWPAE
910 920 930 940 950
DMPFTESGMV PDILFNPHGF PSRMTIGMLI ESMAGKSAAL HGLCHDATPF
960 970 980 990 1000
IFSEENSALE YFGEMLKAAG YNFYGTERLY SGISGLELEA DIFIGVVYYQ
1010 1020 1030 1040 1050
RLRHMVSDKF QVRTTGARDR VTNQPIGGRN VQGGIRFGEM ERDALLAHGT
1060 1070 1080 1090 1100
SFLLHDRLFN CSDRSVAHVC VKCGSLLSPL LEKPPPSWSA MRNRKYNCTL
1110 1120 1130
CSRSDTIDTV SVPYVFRYFV AELAAMNIKV KLDVV
Length:1,135
Mass (Da):128,229
Last modified:April 4, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F019E07F866C22E
GO
Isoform 2 (identifier: Q9H9Y6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-116: Missing.

Show »
Length:1,079
Mass (Da):121,988
Checksum:iFC7A4BB26405E435
GO
Isoform 3 (identifier: Q9H9Y6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRAKEAAETGLRPLLPACTERLASGVYRETGVRCAGGHM

Show »
Length:1,173
Mass (Da):132,240
Checksum:iCFB175CCCE5CFBD4
GO
Isoform 4 (identifier: Q9H9Y6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-211: Missing.

Show »
Length:924
Mass (Da):104,500
Checksum:iCEABB0A34AEC4B1E
GO
Isoform 5 (identifier: Q9H9Y6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-582: EKLEGWLVSI...GIADSLRHFK → GSLPLMELPTDHT

Show »
Length:952
Mass (Da):107,858
Checksum:i222B793DAF1E60BE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C0D9H7C0D9_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
307Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JS83C9JS83_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JJG2C9JJG2_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WAK7F8WAK7_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBB9F8WBB9_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCS3F8WCS3_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDS4F8WDS4_HUMAN
DNA-directed RNA polymerase I subun...
POLR1B
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti247L → R in BAB14082 (PubMed:14702039).Curated1
Sequence conflicti360E → G in AAI10834 (PubMed:15489334).Curated1
Sequence conflicti746I → T in BAB14296 (PubMed:14702039).Curated1
Sequence conflicti800D → G in BAC87247 (PubMed:14702039).Curated1
Sequence conflicti868C → R in BAB14082 (PubMed:14702039).Curated1
Sequence conflicti889Q → R in BAB14082 (PubMed:14702039).Curated1
Sequence conflicti1039E → G in BAH13809 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034476295S → L1 PublicationCorresponds to variant dbSNP:rs1545133Ensembl.1
Natural variantiVAR_071195887H → R. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0567491 – 211Missing in isoform 4. 1 PublicationAdd BLAST211
Alternative sequenceiVSP_0567501M → MRAKEAAETGLRPLLPACTE RLASGVYRETGVRCAGGHM in isoform 3. 1 Publication1
Alternative sequenceiVSP_01782361 – 116Missing in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_056751387 – 582EKLEG…LRHFK → GSLPLMELPTDHT in isoform 5. 1 PublicationAdd BLAST196

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022533 mRNA Translation: BAB14082.1
AK022890 mRNA Translation: BAB14296.1
AK128044 mRNA Translation: BAC87247.1
AK301178 mRNA Translation: BAH13423.1
AK302814 mRNA Translation: BAH13809.1
AC012442 Genomic DNA Translation: AAX81999.1
BC110833 mRNA Translation: AAI10834.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2097.1 [Q9H9Y6-1]
CCDS46395.1 [Q9H9Y6-2]
CCDS62988.1 [Q9H9Y6-3]
CCDS62989.1 [Q9H9Y6-5]
CCDS62990.1 [Q9H9Y6-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001131076.1, NM_001137604.2 [Q9H9Y6-2]
NP_001269701.1, NM_001282772.1 [Q9H9Y6-3]
NP_001269703.1, NM_001282774.1 [Q9H9Y6-5]
NP_001269705.1, NM_001282776.1 [Q9H9Y6-4]
NP_001269706.1, NM_001282777.1
NP_001269708.1, NM_001282779.1
NP_061887.2, NM_019014.5 [Q9H9Y6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263331; ENSP00000263331; ENSG00000125630 [Q9H9Y6-1]
ENST00000409894; ENSP00000387143; ENSG00000125630 [Q9H9Y6-5]
ENST00000417433; ENSP00000405358; ENSG00000125630 [Q9H9Y6-2]
ENST00000537335; ENSP00000437914; ENSG00000125630 [Q9H9Y6-4]
ENST00000541869; ENSP00000444136; ENSG00000125630 [Q9H9Y6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84172

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84172

UCSC genome browser

More...
UCSCi
uc002thw.4 human [Q9H9Y6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022533 mRNA Translation: BAB14082.1
AK022890 mRNA Translation: BAB14296.1
AK128044 mRNA Translation: BAC87247.1
AK301178 mRNA Translation: BAH13423.1
AK302814 mRNA Translation: BAH13809.1
AC012442 Genomic DNA Translation: AAX81999.1
BC110833 mRNA Translation: AAI10834.1
CCDSiCCDS2097.1 [Q9H9Y6-1]
CCDS46395.1 [Q9H9Y6-2]
CCDS62988.1 [Q9H9Y6-3]
CCDS62989.1 [Q9H9Y6-5]
CCDS62990.1 [Q9H9Y6-4]
RefSeqiNP_001131076.1, NM_001137604.2 [Q9H9Y6-2]
NP_001269701.1, NM_001282772.1 [Q9H9Y6-3]
NP_001269703.1, NM_001282774.1 [Q9H9Y6-5]
NP_001269705.1, NM_001282776.1 [Q9H9Y6-4]
NP_001269706.1, NM_001282777.1
NP_001269708.1, NM_001282779.1
NP_061887.2, NM_019014.5 [Q9H9Y6-1]

3D structure databases

SMRiQ9H9Y6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123926, 67 interactors
CORUMiQ9H9Y6
DIPiDIP-27538N
IntActiQ9H9Y6, 31 interactors
MINTiQ9H9Y6
STRINGi9606.ENSP00000444136

PTM databases

iPTMnetiQ9H9Y6
PhosphoSitePlusiQ9H9Y6

Polymorphism and mutation databases

BioMutaiPOLR1B
DMDMi92090637

2D gel databases

SWISS-2DPAGEiQ9H9Y6

Proteomic databases

EPDiQ9H9Y6
jPOSTiQ9H9Y6
MassIVEiQ9H9Y6
MaxQBiQ9H9Y6
PaxDbiQ9H9Y6
PeptideAtlasiQ9H9Y6
PRIDEiQ9H9Y6
ProteomicsDBi25159
30108
81369 [Q9H9Y6-1]
81370 [Q9H9Y6-2]

Genome annotation databases

EnsembliENST00000263331; ENSP00000263331; ENSG00000125630 [Q9H9Y6-1]
ENST00000409894; ENSP00000387143; ENSG00000125630 [Q9H9Y6-5]
ENST00000417433; ENSP00000405358; ENSG00000125630 [Q9H9Y6-2]
ENST00000537335; ENSP00000437914; ENSG00000125630 [Q9H9Y6-4]
ENST00000541869; ENSP00000444136; ENSG00000125630 [Q9H9Y6-3]
GeneIDi84172
KEGGihsa:84172
UCSCiuc002thw.4 human [Q9H9Y6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84172

GeneCards: human genes, protein and diseases

More...
GeneCardsi
POLR1B
HGNCiHGNC:20454 POLR1B
HPAiHPA037528
MIMi602000 gene
neXtProtiNX_Q9H9Y6
OpenTargetsiENSG00000125630
PharmGKBiPA130601182

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0216 Eukaryota
COG0085 LUCA
GeneTreeiENSGT00950000183132
HOGENOMiCLU_000524_5_1_1
InParanoidiQ9H9Y6
KOiK03002
OMAiFFGVVHY
OrthoDBi42570at2759
PhylomeDBiQ9H9Y6
TreeFamiTF103055

Enzyme and pathway databases

ReactomeiR-HSA-427413 NoRC negatively regulates rRNA expression
R-HSA-5250924 B-WICH complex positively regulates rRNA expression
R-HSA-73762 RNA Polymerase I Transcription Initiation
R-HSA-73772 RNA Polymerase I Promoter Escape
R-HSA-73863 RNA Polymerase I Transcription Termination

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
POLR1B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
POLR1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84172
PharosiQ9H9Y6 Tbio

Protein Ontology

More...
PROi
PR:Q9H9Y6
RNActiQ9H9Y6 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000125630 Expressed in buccal mucosa cell and 239 other tissues
ExpressionAtlasiQ9H9Y6 baseline and differential
GenevisibleiQ9H9Y6 HS

Family and domain databases

CDDicd00653 RNA_pol_B_RPB2, 1 hit
Gene3Di2.40.270.10, 1 hit
2.40.50.150, 1 hit
3.90.1110.10, 1 hit
InterProiView protein in InterPro
IPR015712 DNA-dir_RNA_pol_su2
IPR007120 DNA-dir_RNAP_su2_dom
IPR037033 DNA-dir_RNAP_su2_hyb_sf
IPR007121 RNA_pol_bsu_CS
IPR007644 RNA_pol_bsu_protrusion
IPR007642 RNA_pol_Rpb2_2
IPR037034 RNA_pol_Rpb2_2_sf
IPR007645 RNA_pol_Rpb2_3
IPR007641 RNA_pol_Rpb2_7
IPR014724 RNA_pol_RPB2_OB-fold
IPR009674 Rpa2_dom_4
PANTHERiPTHR20856 PTHR20856, 1 hit
PfamiView protein in Pfam
PF06883 RNA_pol_Rpa2_4, 1 hit
PF04563 RNA_pol_Rpb2_1, 1 hit
PF04561 RNA_pol_Rpb2_2, 1 hit
PF04565 RNA_pol_Rpb2_3, 1 hit
PF00562 RNA_pol_Rpb2_6, 1 hit
PF04560 RNA_pol_Rpb2_7, 1 hit
PROSITEiView protein in PROSITE
PS01166 RNA_POL_BETA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H9Y6
Secondary accession number(s): B7Z6Y7
, B7Z823, F5GZX4, F8W898, Q2TAM4, Q585T5, Q6ZRR2, Q9H9D3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: April 4, 2006
Last modified: February 26, 2020
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again