Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 111 (02 Dec 2020)
Sequence version 2 (16 Jun 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Dysbindin domain-containing protein 1

Gene

DBNDD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9H9R9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dysbindin domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DBNDD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000003249.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28455, DBNDD1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H9R9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79007

Open Targets

More...
OpenTargetsi
ENSG00000003249

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA144596443

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H9R9, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DBNDD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
239938618

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002924381 – 158Dysbindin domain-containing protein 1Add BLAST158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei95PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H9R9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H9R9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H9R9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H9R9

PeptideAtlas

More...
PeptideAtlasi
Q9H9R9

PRoteomics IDEntifications database

More...
PRIDEi
Q9H9R9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81352 [Q9H9R9-1]
81353 [Q9H9R9-2]
81354 [Q9H9R9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H9R9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H9R9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000003249, Expressed in right frontal lobe and 158 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H9R9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H9R9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000003249, Tissue enhanced (brain, skeletal muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122478, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000457625

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H9R9, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dysbindin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S0DA, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018903

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_087637_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H9R9

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHSPTAE

Database of Orthologous Groups

More...
OrthoDBi
1524374at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H9R9

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007531, Dysbindin

The PANTHER Classification System

More...
PANTHERi
PTHR16294, PTHR16294, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04440, Dysbindin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H9R9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPPEGAGTG EIVKEAEVPQ AALGVPAQGT GDNGHTPVEE EVGGIPVPAP
60 70 80 90 100
GLLQVTERRQ PLSSVSSLEV HFDLLDLTEL TDMSDQELAE VFADSDDENL
110 120 130 140 150
NTESPAGLHP LPRAGYLRSP SWTRTRAEQS HEKQPLGDPE RQATVLDTFL

TVERPQED
Length:158
Mass (Da):17,042
Last modified:June 16, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i498F80B5002A2C33
GO
Isoform 2 (identifier: Q9H9R9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MEPPEGAGTG → MGETWKNICSTVRHGWWLRDHRMAGLPIPP

Show »
Length:178
Mass (Da):19,643
Checksum:iFB6433859E619A48
GO
Isoform 3 (identifier: Q9H9R9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MEPPEGAGTGE → MTQQWREVNE...RGRQRARPPK

Show »
Length:278
Mass (Da):30,344
Checksum:i8C506340A84A02D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3DX86D3DX86_HUMAN
Dysbindin domain-containing protein...
DBNDD1 MGC3101, hCG_16357
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLZ2H3BLZ2_HUMAN
Dysbindin domain-containing protein...
DBNDD1
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BS76H3BS76_HUMAN
Dysbindin domain-containing protein...
DBNDD1
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26P → S in BAB14152 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0375411 – 11MEPPEGAGTGE → MTQQWREVNEDREAVAQARS WQSLNLGDRDMGVSFIETAL ALSAARARRPLLTSHPPSRP FQPPKHTPSPPPAPRVNSRH PGRSVSLSLPSASQAPPVPL ASPEGRPHTVGAPHASTWKR TRGRQRARPPK in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0262141 – 10MEPPEGAGTG → MGETWKNICSTVRHGWWLRD HRMAGLPIPP in isoform 2. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022644 mRNA Translation: BAB14152.1
AK298932 mRNA Translation: BAG61035.1
AC092143 Genomic DNA No translation available.
BC000700 mRNA Translation: AAH00700.2
AL713678 mRNA Translation: CAH10640.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10991.2 [Q9H9R9-2]
CCDS42223.1 [Q9H9R9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001036075.1, NM_001042610.2 [Q9H9R9-1]
NP_001275637.1, NM_001288708.1
NP_001275638.1, NM_001288709.1
NP_076948.2, NM_024043.3 [Q9H9R9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000002501; ENSP00000002501; ENSG00000003249 [Q9H9R9-1]
ENST00000304733; ENSP00000306407; ENSG00000003249 [Q9H9R9-2]
ENST00000568838; ENSP00000457625; ENSG00000003249 [Q9H9R9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79007

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79007

UCSC genome browser

More...
UCSCi
uc002fqe.2, human [Q9H9R9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022644 mRNA Translation: BAB14152.1
AK298932 mRNA Translation: BAG61035.1
AC092143 Genomic DNA No translation available.
BC000700 mRNA Translation: AAH00700.2
AL713678 mRNA Translation: CAH10640.1
CCDSiCCDS10991.2 [Q9H9R9-2]
CCDS42223.1 [Q9H9R9-1]
RefSeqiNP_001036075.1, NM_001042610.2 [Q9H9R9-1]
NP_001275637.1, NM_001288708.1
NP_001275638.1, NM_001288709.1
NP_076948.2, NM_024043.3 [Q9H9R9-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi122478, 5 interactors
STRINGi9606.ENSP00000457625

PTM databases

iPTMnetiQ9H9R9
PhosphoSitePlusiQ9H9R9

Polymorphism and mutation databases

BioMutaiDBNDD1
DMDMi239938618

Proteomic databases

EPDiQ9H9R9
jPOSTiQ9H9R9
MassIVEiQ9H9R9
PaxDbiQ9H9R9
PeptideAtlasiQ9H9R9
PRIDEiQ9H9R9
ProteomicsDBi81352 [Q9H9R9-1]
81353 [Q9H9R9-2]
81354 [Q9H9R9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
51595, 21 antibodies

Genome annotation databases

EnsembliENST00000002501; ENSP00000002501; ENSG00000003249 [Q9H9R9-1]
ENST00000304733; ENSP00000306407; ENSG00000003249 [Q9H9R9-2]
ENST00000568838; ENSP00000457625; ENSG00000003249 [Q9H9R9-3]
GeneIDi79007
KEGGihsa:79007
UCSCiuc002fqe.2, human [Q9H9R9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79007
DisGeNETi79007
EuPathDBiHostDB:ENSG00000003249.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DBNDD1
HGNCiHGNC:28455, DBNDD1
HPAiENSG00000003249, Tissue enhanced (brain, skeletal muscle)
neXtProtiNX_Q9H9R9
OpenTargetsiENSG00000003249
PharmGKBiPA144596443

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S0DA, Eukaryota
GeneTreeiENSGT00390000018903
HOGENOMiCLU_087637_0_0_1
InParanoidiQ9H9R9
OMAiCHSPTAE
OrthoDBi1524374at2759
PhylomeDBiQ9H9R9

Enzyme and pathway databases

PathwayCommonsiQ9H9R9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79007, 10 hits in 839 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DBNDD1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79007
PharosiQ9H9R9, Tdark

Protein Ontology

More...
PROi
PR:Q9H9R9
RNActiQ9H9R9, protein

Gene expression databases

BgeeiENSG00000003249, Expressed in right frontal lobe and 158 other tissues
ExpressionAtlasiQ9H9R9, baseline and differential
GenevisibleiQ9H9R9, HS

Family and domain databases

InterProiView protein in InterPro
IPR007531, Dysbindin
PANTHERiPTHR16294, PTHR16294, 1 hit
PfamiView protein in Pfam
PF04440, Dysbindin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDBND1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H9R9
Secondary accession number(s): B4DQS3, Q69YT2, Q9BW25
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 16, 2009
Last modified: December 2, 2020
This is version 111 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again