Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (13 Feb 2019)
Sequence version 3 (13 Jul 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Putative E3 ubiquitin-protein ligase UNKL

Gene

UNKL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May participate in a protein complex showing an E3 ligase activity regulated by RAC1. Ubiquitination is directed towards itself and possibly other substrates, such as SMARCD2/BAF60b. Intrinsic E3 ligase activity has not been proven.1 Publication

Caution

Was termed Unkempt.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri75 – 104C3H1-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri115 – 145C3H1-type 2PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri243 – 277C3H1-type 3PROSITE-ProRule annotationAdd BLAST35
Zinc fingeri283 – 310C3H1-type 4PROSITE-ProRule annotationAdd BLAST28
Zinc fingeri639 – 674RING-typePROSITE-ProRule annotationAdd BLAST36

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Putative E3 ubiquitin-protein ligase UNKL (EC:2.3.2.-)
Alternative name(s):
RING finger protein unkempt-like
Zinc finger CCCH domain-containing protein 5-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UNKL
Synonyms:C16orf28, ZC3H5L, ZC3HDC5L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000059145.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14184 UNKL

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617463 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H9P5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi639C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-670. 1 Publication1
Mutagenesisi670C → A: No effects on the interaction with RAC1 or SMARCD2; when associated with A-639. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000059145

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37855

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UNKL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
300669704

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002786671 – 680Putative E3 ubiquitin-protein ligase UNKLAdd BLAST680

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 4 is ubiquitinated in the C-terminal. Ubiquitination is enhanced by activated RAC1. The presence of the RING finger domain is not essential for ubiquitination to occur.

Keywords - PTMi

Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H9P5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H9P5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H9P5

PeptideAtlas

More...
PeptideAtlasi
Q9H9P5

PRoteomics IDEntifications database

More...
PRIDEi
Q9H9P5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81339
81340 [Q9H9P5-1]
81341 [Q9H9P5-2]
81342 [Q9H9P5-3]
81343 [Q9H9P5-5]
81344 [Q9H9P5-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H9P5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H9P5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000059145 Expressed in 206 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H9P5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H9P5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA055801
HPA073949

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 4 (C-terminal) interacts with the GTP-bound form of RAC1. Isoform 4 (C-terminal) interacts with SMARCD2/BAF60b.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122243, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9H9P5, 25 interactors

Molecular INTeraction database

More...
MINTi
Q9H9P5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373873

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9H9P5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H9P5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili563 – 619Sequence analysisAdd BLAST57

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi7 – 11Poly-Ala5
Compositional biasi61 – 64Poly-Arg4
Compositional biasi374 – 561Ser-richAdd BLAST188

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Although this protein contains a RING domain, intrinsic E3 ligase activity has not been proven.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the unkempt family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri75 – 104C3H1-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri115 – 145C3H1-type 2PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri243 – 277C3H1-type 3PROSITE-ProRule annotationAdd BLAST35
Zinc fingeri283 – 310C3H1-type 4PROSITE-ProRule annotationAdd BLAST28
Zinc fingeri639 – 674RING-typePROSITE-ProRule annotationAdd BLAST36

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1100 Eukaryota
KOG1595 Eukaryota
ENOG410XR0Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158822

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG094136

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H9P5

KEGG Orthology (KO)

More...
KOi
K23047

Database of Orthologous Groups

More...
OrthoDBi
720138at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H9P5

TreeFam database of animal gene trees

More...
TreeFami
TF314982

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040594 Unkempt_zf
IPR000571 Znf_CCCH
IPR036855 Znf_CCCH_sf
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00642 zf-CCCH, 1 hit
PF18384 zf_CCCH_5, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00356 ZnF_C3H1, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF90229 SSF90229, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50103 ZF_C3H1, 4 hits
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 4 (identifier: Q9H9P5-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSVSKAAAA ALSGSPPQTE KPTHYRYLKE FRTEQCPLFS QHKCAQHRPF
60 70 80 90 100
TCFHWHFLNQ RRRRPLRRRD GTFNYSPDVY CSKYNEATGV CPDGDECPYL
110 120 130 140 150
HRTTGDTERK YHLRYYKTGT CIHETDARGH CVKNGLHCAF AHGPLDLRPP
160 170 180 190 200
VCDVRELQAQ EALQNGQLGG GEGVPDLQPG VLASQAMIEK ILSEDPRWQD
210 220 230 240 250
ANFVLGSYKT EQCPKPPRLC RQGYACPHYH NSRDRRRNPR RFQYRSTPCP
260 270 280 290 300
SVKHGDEWGE PSRCDGGDGC QYCHSRTEQQ FHPESTKCND MRQTGYCPRG
310 320 330 340 350
PFCAFAHVEK SLGMVNEWGC HDLHLTSPSS TGSGQPGNAK RRDSPAEGGP
360 370 380 390 400
RGSEQDSKQN HLAVFAAVHP PAPSVSSSVA SSLASSAGSG SSSPTALPAP
410 420 430 440 450
PARALPLGPA SSTVEAVLGS ALDLHLSNVN IASLEKDLEE QDGHDLGAAG
460 470 480 490 500
PRSLAGSAPV AIPGSLPRAP SLHSPSSAST SPLGSLSQPL PGPVGSSAMT
510 520 530 540 550
PPQQPPPLRS EPGTLGSAAS SYSPLGLNGV PGSIWDFVSG SFSPSPSPIL
560 570 580 590 600
SAGPPSSSSA SPNGAELARV RRQLDEAKRK IRQWEESWQQ VKQVCDAWQR
610 620 630 640 650
EAQEAKERAR VADSDRQLAL QKKEEVEAQV IFQLRAKQCV ACRERAHGAV
660 670 680
LRPCQHHILC EPCAATAPEC PYCKGQPLQW
Note: Splice site between exons 6 and 7 is non-canonical.
Length:680
Mass (Da):73,828
Last modified:July 13, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFC3205EB1616075E
GO
Isoform 1 (identifier: Q9H9P5-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:232
Mass (Da):25,229
Checksum:iFAE1860922258EE2
GO
Isoform 2 (identifier: Q9H9P5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-498: Missing.

Show »
Length:182
Mass (Da):19,981
Checksum:iAAB878A688027506
GO
Isoform 3 (identifier: Q9H9P5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-501: Missing.
     502-525: PQQPPPLRSEPGTLGSAASSYSPL → MTCCSQVPPRRRPSLALSPRLDCN
     630-630: V → VKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGV

Show »
Length:229
Mass (Da):25,163
Checksum:i09E116107AE15BBB
GO
Isoform 5 (identifier: Q9H9P5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-277: RSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRT → SWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA
     278-680: Missing.

Show »
Length:277
Mass (Da):31,752
Checksum:iE2BBA5DFC89DA3AF
GO
Isoform 6 (identifier: Q9H9P5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-96: E → ESLLGVLYPL...GVWWTLLGFR
     199-199: Q → QALLPVALLRHRVAHFS
     284-284: E → EGPVGSPVSG...PHVCVFPIYK
     359-359: Q → QGVRAHGVYVFEQ
     419-554: GSALDLHLSN...SPSPILSAGP → ALEPTPSSPT...HRQDTRPVPS
     555-680: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):81,571
Checksum:iD724666951448E24
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PDK2E9PDK2_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
733Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MRZ1A0A0A0MRZ1_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
683Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSC7A0A0A0MSC7_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E2QRG9E2QRG9_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RA68D6RA68_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSF0A0A0A0MSF0_HUMAN
Putative E3 ubiquitin-protein ligas...
UNKL
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti541S → R in CAQ16184 (PubMed:20148946).Curated1
Sequence conflicti549I → V in BAB14178 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0394321 – 501Missing in isoform 3. 1 PublicationAdd BLAST501
Alternative sequenceiVSP_0394331 – 498Missing in isoform 1 and isoform 2. 1 PublicationAdd BLAST498
Alternative sequenceiVSP_03943496E → ESLLGVLYPLWAPPPVPAPV GAPTVHPFLARWFSHVPWEP AGSADPRASSTPAGGTTWAT GLLGDFDACGSQSRECVKGV WWTLLGFR in isoform 6. Curated1
Alternative sequenceiVSP_039435199Q → QALLPVALLRHRVAHFS in isoform 6. Curated1
Alternative sequenceiVSP_039436245 – 277RSTPC…CHSRT → SWQLGRRVLRLSPRANNPRV ALPRVHTGPSSTA in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_039437278 – 680Missing in isoform 5. 1 PublicationAdd BLAST403
Alternative sequenceiVSP_039438284E → EGPVGSPVSGAFSVFSHAGL VADPSLWYPAEWSWHHVGHS RTINPEGDKPSRLGPAPENI KRGNDFACDGRADAAGMAPH VCVFPIYK in isoform 6. Curated1
Alternative sequenceiVSP_039439359Q → QGVRAHGVYVFEQ in isoform 6. Curated1
Alternative sequenceiVSP_039440419 – 554GSALD…LSAGP → ALEPTPSSPTSSAVQGVAGE LGMGSGGQGCWSHVVGALAA VPAWTHSGDLEWDPSTIRTR VNVGGGPAARPAMTLAREPQ LLVVGGCPTRNCSGPAASPQ QLLDDAGQGGRGERDSSQRP LRPQTTHRQDTRPVPS in isoform 6. CuratedAdd BLAST136
Alternative sequenceiVSP_039441502 – 525PQQPP…SYSPL → MTCCSQVPPRRRPSLALSPR LDCN in isoform 3. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_039442555 – 680Missing in isoform 6. CuratedAdd BLAST126
Alternative sequenceiVSP_039443630V → VKQLQEELEGLGVASTLPGL RGCGDIGTIPLPKLHSLQSQ LRLDLEAVDGV in isoform 1 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AM944365 mRNA Translation: CAQ16184.1
AK022685 mRNA Translation: BAB14178.1
AK027013 mRNA Translation: BAB15626.1
AE006467 Genomic DNA Translation: AAK61278.1
AE006467 Genomic DNA Translation: AAK61279.1
AL031709 Genomic DNA No translation available.
AL031721 Genomic DNA No translation available.
AL032819 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85659.1
CH471112 Genomic DNA Translation: EAW85660.1
CH471112 Genomic DNA Translation: EAW85662.1
BC000150 mRNA Translation: AAH00150.1
BC011924 mRNA Translation: AAH11924.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32359.1 [Q9H9P5-5]
CCDS53980.1 [Q9H9P5-2]
CCDS61787.1 [Q9H9P5-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T45063

NCBI Reference Sequences

More...
RefSeqi
NP_001032202.1, NM_001037125.3 [Q9H9P5-5]
NP_001180317.2, NM_001193388.3
NP_001180318.1, NM_001193389.1 [Q9H9P5-2]
NP_001263343.1, NM_001276414.1 [Q9H9P5-3]
XP_016879057.1, XM_017023568.1 [Q9H9P5-1]
XP_016879058.1, XM_017023569.1 [Q9H9P5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.643536
Hs.745452

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000248104; ENSP00000248104; ENSG00000059145 [Q9H9P5-3]
ENST00000301712; ENSP00000301712; ENSG00000059145 [Q9H9P5-5]
ENST00000397464; ENSP00000380606; ENSG00000059145 [Q9H9P5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64718

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64718

UCSC genome browser

More...
UCSCi
uc002clo.3 human [Q9H9P5-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM944365 mRNA Translation: CAQ16184.1
AK022685 mRNA Translation: BAB14178.1
AK027013 mRNA Translation: BAB15626.1
AE006467 Genomic DNA Translation: AAK61278.1
AE006467 Genomic DNA Translation: AAK61279.1
AL031709 Genomic DNA No translation available.
AL031721 Genomic DNA No translation available.
AL032819 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85659.1
CH471112 Genomic DNA Translation: EAW85660.1
CH471112 Genomic DNA Translation: EAW85662.1
BC000150 mRNA Translation: AAH00150.1
BC011924 mRNA Translation: AAH11924.1
CCDSiCCDS32359.1 [Q9H9P5-5]
CCDS53980.1 [Q9H9P5-2]
CCDS61787.1 [Q9H9P5-3]
PIRiT45063
RefSeqiNP_001032202.1, NM_001037125.3 [Q9H9P5-5]
NP_001180317.2, NM_001193388.3
NP_001180318.1, NM_001193389.1 [Q9H9P5-2]
NP_001263343.1, NM_001276414.1 [Q9H9P5-3]
XP_016879057.1, XM_017023568.1 [Q9H9P5-1]
XP_016879058.1, XM_017023569.1 [Q9H9P5-1]
UniGeneiHs.643536
Hs.745452

3D structure databases

ProteinModelPortaliQ9H9P5
SMRiQ9H9P5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122243, 7 interactors
IntActiQ9H9P5, 25 interactors
MINTiQ9H9P5
STRINGi9606.ENSP00000373873

PTM databases

iPTMnetiQ9H9P5
PhosphoSitePlusiQ9H9P5

Polymorphism and mutation databases

BioMutaiUNKL
DMDMi300669704

Proteomic databases

EPDiQ9H9P5
jPOSTiQ9H9P5
PaxDbiQ9H9P5
PeptideAtlasiQ9H9P5
PRIDEiQ9H9P5
ProteomicsDBi81339
81340 [Q9H9P5-1]
81341 [Q9H9P5-2]
81342 [Q9H9P5-3]
81343 [Q9H9P5-5]
81344 [Q9H9P5-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248104; ENSP00000248104; ENSG00000059145 [Q9H9P5-3]
ENST00000301712; ENSP00000301712; ENSG00000059145 [Q9H9P5-5]
ENST00000397464; ENSP00000380606; ENSG00000059145 [Q9H9P5-2]
GeneIDi64718
KEGGihsa:64718
UCSCiuc002clo.3 human [Q9H9P5-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64718
EuPathDBiHostDB:ENSG00000059145.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UNKL
HGNCiHGNC:14184 UNKL
HPAiHPA055801
HPA073949
MIMi617463 gene
neXtProtiNX_Q9H9P5
OpenTargetsiENSG00000059145
PharmGKBiPA37855

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1100 Eukaryota
KOG1595 Eukaryota
ENOG410XR0Z LUCA
GeneTreeiENSGT00940000158822
HOVERGENiHBG094136
InParanoidiQ9H9P5
KOiK23047
OrthoDBi720138at2759
PhylomeDBiQ9H9P5
TreeFamiTF314982

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UNKL human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UNKL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64718

Protein Ontology

More...
PROi
PR:Q9H9P5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000059145 Expressed in 206 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ9H9P5 baseline and differential
GenevisibleiQ9H9P5 HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR040594 Unkempt_zf
IPR000571 Znf_CCCH
IPR036855 Znf_CCCH_sf
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00642 zf-CCCH, 1 hit
PF18384 zf_CCCH_5, 1 hit
SMARTiView protein in SMART
SM00356 ZnF_C3H1, 4 hits
SUPFAMiSSF90229 SSF90229, 1 hit
PROSITEiView protein in PROSITE
PS50103 ZF_C3H1, 4 hits
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUNKL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H9P5
Secondary accession number(s): B0QYN6
, B1GXI8, Q96EV1, Q96RZ1, Q9BWL5, Q9H5K0, Q9UJJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 6, 2007
Last sequence update: July 13, 2010
Last modified: February 13, 2019
This is version 141 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again