Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (13 Nov 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

CCR4-NOT transcription complex subunit 10

Gene

CNOT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Is not required for association of CNOT7 to the CCR4-NOT complex.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processRNA-mediated gene silencing, Transcription, Transcription regulation, Translation regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CNOT10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23817 CNOT10

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H9A5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134862503

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H9A5

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4105878

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CNOT10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733982

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003145792 – 744CCR4-NOT transcription complex subunit 10Add BLAST743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H9A5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H9A5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H9A5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H9A5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H9A5

PeptideAtlas

More...
PeptideAtlasi
Q9H9A5

PRoteomics IDEntifications database

More...
PRIDEi
Q9H9A5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
30485
81300 [Q9H9A5-1]
81301 [Q9H9A5-2]
81302 [Q9H9A5-3]
81303 [Q9H9A5-4]
81304 [Q9H9A5-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H9A5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H9A5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182973 Expressed in 151 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H9A5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H9A5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035614
HPA041450

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits. CNOT10 and CNOT11 form a subcomplex docked to the CNOT1 scaffold.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117411, 55 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H9A5

Database of interacting proteins

More...
DIPi
DIP-46839N

Protein interaction database and analysis system

More...
IntActi
Q9H9A5, 41 interactors

Molecular INTeraction database

More...
MINTi
Q9H9A5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000399862

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili74 – 107Sequence analysisAdd BLAST34

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CNOT10 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2471 Eukaryota
ENOG410XQQJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000001827

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111843

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H9A5

KEGG Orthology (KO)

More...
KOi
K12607

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECTQAGT

Database of Orthologous Groups

More...
OrthoDBi
249353at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H9A5

TreeFam database of animal gene trees

More...
TreeFami
TF323368

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039740 CNOT10
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

The PANTHER Classification System

More...
PANTHERi
PTHR12979 PTHR12979, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00028 TPR, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H9A5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAADKPADQG AEKHEGTGQS SGITDQEKEL STNAFQAFTS GNYDACLQHL
60 70 80 90 100
ACLQDINKDD YKIILNTAVA EFFKSNQTTT DNLRQTLNQL KNQVHSAVEE
110 120 130 140 150
MDGLDDVENS MLYYNQAVIL YHLRQYTEAI SVGEKLYQFI EPFEEKFAQA
160 170 180 190 200
VCFLLVDLYI LTYQAEKALH LLAVLEKMIS QGNNNKNGKN ETGNNNNKDG
210 220 230 240 250
SNHKAESGAL IEAAKSKIHQ YKVRAYIQMK SLKACKREIK SVMNTAGNSA
260 270 280 290 300
PSLFLKSNFE YLRGNYRKAV KLLNSSNIAE HPGFMKTGEC LRCMFWNNLG
310 320 330 340 350
CIHFAMSKHN LGIFYFKKAL QENDNVCAQL SAGSTDPGKK FSGRPMCTLL
360 370 380 390 400
TNKRYELLYN CGIQLLHIGR PLAAFECLIE AVQVYHANPR LWLRLAECCI
410 420 430 440 450
AANKGTSEQE TKGLPSKKGI VQSIVGQGYH RKIVLASQSI QNTVYNDGQS
460 470 480 490 500
SAIPVASMEF AAICLRNALL LLPEEQQDPK QENGAKNSNQ LGGNTESSES
510 520 530 540 550
SETCSSKSHD GDKFIPAPPS SPLRKQELEN LKCSILACSA YVALALGDNL
560 570 580 590 600
MALNHADKLL QQPKLSGSLK FLGHLYAAEA LISLDRISDA ITHLNPENVT
610 620 630 640 650
DVSLGISSNE QDQGSDKGEN EAMESSGKRA PQCYPSSVNS ARTVMLFNLG
660 670 680 690 700
SAYCLRSEYD KARKCLHQAA SMIHPKEVPP EAILLAVYLE LQNGNTQLAL
710 720 730 740
QIIKRNQLLP AVKTHSEVRK KPVFQPVHPI QPIQMPAFTT VQRK
Length:744
Mass (Da):82,310
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBA1984B71F0A1E7A
GO
Isoform 2 (identifier: Q9H9A5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-144: Missing.

Show »
Length:743
Mass (Da):82,181
Checksum:i46D04260B4E124E7
GO
Isoform 3 (identifier: Q9H9A5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R

Show »
Length:717
Mass (Da):79,377
Checksum:i4981E1632AB0368B
GO
Isoform 4 (identifier: Q9H9A5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R
     556-577: Missing.

Show »
Length:695
Mass (Da):76,968
Checksum:iDEA9C9A66A253FE1
GO
Isoform 5 (identifier: Q9H9A5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-293: Missing.

Show »
Length:451
Mass (Da):49,483
Checksum:i8F1BA3511B5863D5
GO
Isoform 6 (identifier: Q9H9A5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAADKPA → MKSIGVKTVKVCGSKSSVRIEGQPCSLGQSRRKVKLMGERSYTLSIGNGDYFWANKEMLWDYVQTLS

Note: No experimental confirmation available.
Show »
Length:804
Mass (Da):89,141
Checksum:iB1B0728C82613355
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PCN5E9PCN5_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
609Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1X9H7C1X9_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0K1H7C0K1_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZZ7H7BZZ7_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13876 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5K → R in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti52C → R in BAB14478 (PubMed:14702039).Curated1
Sequence conflicti270V → M in BAB13876 (PubMed:14702039).Curated1
Sequence conflicti478D → G in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti509H → Y in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti518P → L in BAH13647 (PubMed:14702039).Curated1
Sequence conflicti622A → T in BAB14478 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053982348T → S1 PublicationCorresponds to variant dbSNP:rs11558687Ensembl.1
Natural variantiVAR_037957736P → S1 PublicationCorresponds to variant dbSNP:rs17849684Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0303111 – 293Missing in isoform 5. 1 PublicationAdd BLAST293
Alternative sequenceiVSP_0455571 – 7MAADKPA → MKSIGVKTVKVCGSKSSVRI EGQPCSLGQSRRKVKLMGER SYTLSIGNGDYFWANKEMLW DYVQTLS in isoform 6. 1 Publication7
Alternative sequenceiVSP_030312144Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_030313505 – 532SSKSH…LENLK → R in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_030314556 – 577Missing in isoform 4. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK021695 mRNA Translation: BAB13876.1 Different initiation.
AK022576 mRNA Translation: BAB14108.1
AK022952 mRNA Translation: BAB14327.1
AK023227 mRNA Translation: BAB14478.1
AK027026 mRNA Translation: BAB15629.1
AK302196 mRNA Translation: BAH13647.1
AC138972 Genomic DNA No translation available.
AC139452 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64435.1
BC002928 mRNA Translation: AAH02928.1
BC002931 mRNA Translation: AAH02931.1
AL117639 mRNA Translation: CAB56027.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2655.1 [Q9H9A5-1]
CCDS58821.1 [Q9H9A5-3]
CCDS58822.1 [Q9H9A5-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001243670.1, NM_001256741.1 [Q9H9A5-3]
NP_001243671.1, NM_001256742.1 [Q9H9A5-6]
NP_056257.1, NM_015442.2 [Q9H9A5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000328834; ENSP00000330060; ENSG00000182973 [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973 [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973 [Q9H9A5-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25904

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25904

UCSC genome browser

More...
UCSCi
uc003cfc.2 human [Q9H9A5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021695 mRNA Translation: BAB13876.1 Different initiation.
AK022576 mRNA Translation: BAB14108.1
AK022952 mRNA Translation: BAB14327.1
AK023227 mRNA Translation: BAB14478.1
AK027026 mRNA Translation: BAB15629.1
AK302196 mRNA Translation: BAH13647.1
AC138972 Genomic DNA No translation available.
AC139452 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64435.1
BC002928 mRNA Translation: AAH02928.1
BC002931 mRNA Translation: AAH02931.1
AL117639 mRNA Translation: CAB56027.2
CCDSiCCDS2655.1 [Q9H9A5-1]
CCDS58821.1 [Q9H9A5-3]
CCDS58822.1 [Q9H9A5-6]
RefSeqiNP_001243670.1, NM_001256741.1 [Q9H9A5-3]
NP_001243671.1, NM_001256742.1 [Q9H9A5-6]
NP_056257.1, NM_015442.2 [Q9H9A5-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117411, 55 interactors
CORUMiQ9H9A5
DIPiDIP-46839N
IntActiQ9H9A5, 41 interactors
MINTiQ9H9A5
STRINGi9606.ENSP00000399862

Chemistry databases

ChEMBLiCHEMBL4105878

PTM databases

iPTMnetiQ9H9A5
PhosphoSitePlusiQ9H9A5

Polymorphism and mutation databases

BioMutaiCNOT10
DMDMi74733982

Proteomic databases

EPDiQ9H9A5
jPOSTiQ9H9A5
MassIVEiQ9H9A5
MaxQBiQ9H9A5
PaxDbiQ9H9A5
PeptideAtlasiQ9H9A5
PRIDEiQ9H9A5
ProteomicsDBi30485
81300 [Q9H9A5-1]
81301 [Q9H9A5-2]
81302 [Q9H9A5-3]
81303 [Q9H9A5-4]
81304 [Q9H9A5-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
25904

Genome annotation databases

EnsembliENST00000328834; ENSP00000330060; ENSG00000182973 [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973 [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973 [Q9H9A5-6]
GeneIDi25904
KEGGihsa:25904
UCSCiuc003cfc.2 human [Q9H9A5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25904

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CNOT10
HGNCiHGNC:23817 CNOT10
HPAiHPA035614
HPA041450
neXtProtiNX_Q9H9A5
PharmGKBiPA134862503

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2471 Eukaryota
ENOG410XQQJ LUCA
GeneTreeiENSGT00390000001827
HOGENOMiHOG000111843
InParanoidiQ9H9A5
KOiK12607
OMAiECTQAGT
OrthoDBi249353at2759
PhylomeDBiQ9H9A5
TreeFamiTF323368

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CNOT10 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25904
PharosiQ9H9A5

Protein Ontology

More...
PROi
PR:Q9H9A5

Gene expression databases

BgeeiENSG00000182973 Expressed in 151 organ(s), highest expression level in testis
ExpressionAtlasiQ9H9A5 baseline and differential
GenevisibleiQ9H9A5 HS

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR039740 CNOT10
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PANTHERiPTHR12979 PTHR12979, 1 hit
SMARTiView protein in SMART
SM00028 TPR, 4 hits
SUPFAMiSSF48452 SSF48452, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNO10_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H9A5
Secondary accession number(s): B7Z7L1
, F8WAF2, Q9BU30, Q9H5J7, Q9H8X1, Q9H9W0, Q9HAH3, Q9UFJ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: March 1, 2001
Last modified: November 13, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again