Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CCR4-NOT transcription complex subunit 10

Gene

CNOT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Is not required for association of CNOT7 to the CCR4-NOT complex.1 Publication

GO - Biological processi

Keywordsi

Biological processRNA-mediated gene silencing, Transcription, Transcription regulation, Translation regulation

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Names & Taxonomyi

Protein namesi
Recommended name:
CCR4-NOT transcription complex subunit 10
Gene namesi
Name:CNOT10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000182973.18
HGNCiHGNC:23817 CNOT10
neXtProtiNX_Q9H9A5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134862503

Polymorphism and mutation databases

BioMutaiCNOT10
DMDMi74733982

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003145792 – 744CCR4-NOT transcription complex subunit 10Add BLAST743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9H9A5
MaxQBiQ9H9A5
PaxDbiQ9H9A5
PeptideAtlasiQ9H9A5
PRIDEiQ9H9A5
ProteomicsDBi81300
81301 [Q9H9A5-2]
81302 [Q9H9A5-3]
81303 [Q9H9A5-4]
81304 [Q9H9A5-5]

PTM databases

iPTMnetiQ9H9A5
PhosphoSitePlusiQ9H9A5

Expressioni

Gene expression databases

BgeeiENSG00000182973 Expressed in 151 organ(s), highest expression level in testis
CleanExiHS_CNOT10
ExpressionAtlasiQ9H9A5 baseline and differential
GenevisibleiQ9H9A5 HS

Organism-specific databases

HPAiHPA035614
HPA041450

Interactioni

Subunit structurei

Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits. CNOT10 and CNOT11 form a subcomplex docked to the CNOT1 scaffold.2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi117411, 50 interactors
CORUMiQ9H9A5
DIPiDIP-46839N
IntActiQ9H9A5, 24 interactors
MINTiQ9H9A5
STRINGi9606.ENSP00000330060

Structurei

3D structure databases

ProteinModelPortaliQ9H9A5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili74 – 107Sequence analysisAdd BLAST34

Sequence similaritiesi

Belongs to the CNOT10 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2471 Eukaryota
ENOG410XQQJ LUCA
GeneTreeiENSGT00390000001827
HOGENOMiHOG000111843
HOVERGENiHBG077464
InParanoidiQ9H9A5
KOiK12607
OMAiGKHNLGI
OrthoDBiEOG091G06Q4
PhylomeDBiQ9H9A5
TreeFamiTF323368

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
SMARTiView protein in SMART
SM00028 TPR, 4 hits
SUPFAMiSSF48452 SSF48452, 8 hits

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H9A5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAADKPADQG AEKHEGTGQS SGITDQEKEL STNAFQAFTS GNYDACLQHL
60 70 80 90 100
ACLQDINKDD YKIILNTAVA EFFKSNQTTT DNLRQTLNQL KNQVHSAVEE
110 120 130 140 150
MDGLDDVENS MLYYNQAVIL YHLRQYTEAI SVGEKLYQFI EPFEEKFAQA
160 170 180 190 200
VCFLLVDLYI LTYQAEKALH LLAVLEKMIS QGNNNKNGKN ETGNNNNKDG
210 220 230 240 250
SNHKAESGAL IEAAKSKIHQ YKVRAYIQMK SLKACKREIK SVMNTAGNSA
260 270 280 290 300
PSLFLKSNFE YLRGNYRKAV KLLNSSNIAE HPGFMKTGEC LRCMFWNNLG
310 320 330 340 350
CIHFAMSKHN LGIFYFKKAL QENDNVCAQL SAGSTDPGKK FSGRPMCTLL
360 370 380 390 400
TNKRYELLYN CGIQLLHIGR PLAAFECLIE AVQVYHANPR LWLRLAECCI
410 420 430 440 450
AANKGTSEQE TKGLPSKKGI VQSIVGQGYH RKIVLASQSI QNTVYNDGQS
460 470 480 490 500
SAIPVASMEF AAICLRNALL LLPEEQQDPK QENGAKNSNQ LGGNTESSES
510 520 530 540 550
SETCSSKSHD GDKFIPAPPS SPLRKQELEN LKCSILACSA YVALALGDNL
560 570 580 590 600
MALNHADKLL QQPKLSGSLK FLGHLYAAEA LISLDRISDA ITHLNPENVT
610 620 630 640 650
DVSLGISSNE QDQGSDKGEN EAMESSGKRA PQCYPSSVNS ARTVMLFNLG
660 670 680 690 700
SAYCLRSEYD KARKCLHQAA SMIHPKEVPP EAILLAVYLE LQNGNTQLAL
710 720 730 740
QIIKRNQLLP AVKTHSEVRK KPVFQPVHPI QPIQMPAFTT VQRK
Length:744
Mass (Da):82,310
Last modified:March 1, 2001 - v1
Checksum:iBA1984B71F0A1E7A
GO
Isoform 2 (identifier: Q9H9A5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-144: Missing.

Show »
Length:743
Mass (Da):82,181
Checksum:i46D04260B4E124E7
GO
Isoform 3 (identifier: Q9H9A5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R

Show »
Length:717
Mass (Da):79,377
Checksum:i4981E1632AB0368B
GO
Isoform 4 (identifier: Q9H9A5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     505-532: SSKSHDGDKFIPAPPSSPLRKQELENLK → R
     556-577: Missing.

Show »
Length:695
Mass (Da):76,968
Checksum:iDEA9C9A66A253FE1
GO
Isoform 5 (identifier: Q9H9A5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-293: Missing.

Show »
Length:451
Mass (Da):49,483
Checksum:i8F1BA3511B5863D5
GO
Isoform 6 (identifier: Q9H9A5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAADKPA → MKSIGVKTVKVCGSKSSVRIEGQPCSLGQSRRKVKLMGERSYTLSIGNGDYFWANKEMLWDYVQTLS

Note: No experimental confirmation available.
Show »
Length:804
Mass (Da):89,141
Checksum:iB1B0728C82613355
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PCN5E9PCN5_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
609Annotation score:
H7C1X9H7C1X9_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
210Annotation score:
H7C0K1H7C0K1_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
229Annotation score:
H7BZZ7H7BZZ7_HUMAN
CCR4-NOT transcription complex subu...
CNOT10
43Annotation score:

Sequence cautioni

The sequence BAB13876 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5K → R in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti52C → R in BAB14478 (PubMed:14702039).Curated1
Sequence conflicti270V → M in BAB13876 (PubMed:14702039).Curated1
Sequence conflicti478D → G in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti509H → Y in BAB14108 (PubMed:14702039).Curated1
Sequence conflicti518P → L in BAH13647 (PubMed:14702039).Curated1
Sequence conflicti622A → T in BAB14478 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053982348T → S1 PublicationCorresponds to variant dbSNP:rs11558687Ensembl.1
Natural variantiVAR_037957736P → S1 PublicationCorresponds to variant dbSNP:rs17849684Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0303111 – 293Missing in isoform 5. 1 PublicationAdd BLAST293
Alternative sequenceiVSP_0455571 – 7MAADKPA → MKSIGVKTVKVCGSKSSVRI EGQPCSLGQSRRKVKLMGER SYTLSIGNGDYFWANKEMLW DYVQTLS in isoform 6. 1 Publication7
Alternative sequenceiVSP_030312144Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_030313505 – 532SSKSH…LENLK → R in isoform 3 and isoform 4. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_030314556 – 577Missing in isoform 4. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021695 mRNA Translation: BAB13876.1 Different initiation.
AK022576 mRNA Translation: BAB14108.1
AK022952 mRNA Translation: BAB14327.1
AK023227 mRNA Translation: BAB14478.1
AK027026 mRNA Translation: BAB15629.1
AK302196 mRNA Translation: BAH13647.1
AC138972 Genomic DNA No translation available.
AC139452 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64435.1
BC002928 mRNA Translation: AAH02928.1
BC002931 mRNA Translation: AAH02931.1
AL117639 mRNA Translation: CAB56027.2
CCDSiCCDS2655.1 [Q9H9A5-1]
CCDS58821.1 [Q9H9A5-3]
CCDS58822.1 [Q9H9A5-6]
RefSeqiNP_001243670.1, NM_001256741.1 [Q9H9A5-3]
NP_001243671.1, NM_001256742.1 [Q9H9A5-6]
NP_056257.1, NM_015442.2 [Q9H9A5-1]
UniGeneiHs.444851

Genome annotation databases

EnsembliENST00000328834; ENSP00000330060; ENSG00000182973 [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973 [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973 [Q9H9A5-6]
GeneIDi25904
KEGGihsa:25904
UCSCiuc003cfc.2 human [Q9H9A5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021695 mRNA Translation: BAB13876.1 Different initiation.
AK022576 mRNA Translation: BAB14108.1
AK022952 mRNA Translation: BAB14327.1
AK023227 mRNA Translation: BAB14478.1
AK027026 mRNA Translation: BAB15629.1
AK302196 mRNA Translation: BAH13647.1
AC138972 Genomic DNA No translation available.
AC139452 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64435.1
BC002928 mRNA Translation: AAH02928.1
BC002931 mRNA Translation: AAH02931.1
AL117639 mRNA Translation: CAB56027.2
CCDSiCCDS2655.1 [Q9H9A5-1]
CCDS58821.1 [Q9H9A5-3]
CCDS58822.1 [Q9H9A5-6]
RefSeqiNP_001243670.1, NM_001256741.1 [Q9H9A5-3]
NP_001243671.1, NM_001256742.1 [Q9H9A5-6]
NP_056257.1, NM_015442.2 [Q9H9A5-1]
UniGeneiHs.444851

3D structure databases

ProteinModelPortaliQ9H9A5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117411, 50 interactors
CORUMiQ9H9A5
DIPiDIP-46839N
IntActiQ9H9A5, 24 interactors
MINTiQ9H9A5
STRINGi9606.ENSP00000330060

PTM databases

iPTMnetiQ9H9A5
PhosphoSitePlusiQ9H9A5

Polymorphism and mutation databases

BioMutaiCNOT10
DMDMi74733982

Proteomic databases

EPDiQ9H9A5
MaxQBiQ9H9A5
PaxDbiQ9H9A5
PeptideAtlasiQ9H9A5
PRIDEiQ9H9A5
ProteomicsDBi81300
81301 [Q9H9A5-2]
81302 [Q9H9A5-3]
81303 [Q9H9A5-4]
81304 [Q9H9A5-5]

Protocols and materials databases

DNASUi25904
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328834; ENSP00000330060; ENSG00000182973 [Q9H9A5-1]
ENST00000331889; ENSP00000329376; ENSG00000182973 [Q9H9A5-3]
ENST00000454516; ENSP00000399862; ENSG00000182973 [Q9H9A5-6]
GeneIDi25904
KEGGihsa:25904
UCSCiuc003cfc.2 human [Q9H9A5-1]

Organism-specific databases

CTDi25904
EuPathDBiHostDB:ENSG00000182973.18
GeneCardsiCNOT10
HGNCiHGNC:23817 CNOT10
HPAiHPA035614
HPA041450
neXtProtiNX_Q9H9A5
PharmGKBiPA134862503
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2471 Eukaryota
ENOG410XQQJ LUCA
GeneTreeiENSGT00390000001827
HOGENOMiHOG000111843
HOVERGENiHBG077464
InParanoidiQ9H9A5
KOiK12607
OMAiGKHNLGI
OrthoDBiEOG091G06Q4
PhylomeDBiQ9H9A5
TreeFamiTF323368

Enzyme and pathway databases

ReactomeiR-HSA-429947 Deadenylation of mRNA
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Miscellaneous databases

ChiTaRSiCNOT10 human
GenomeRNAii25904
PROiPR:Q9H9A5

Gene expression databases

BgeeiENSG00000182973 Expressed in 151 organ(s), highest expression level in testis
CleanExiHS_CNOT10
ExpressionAtlasiQ9H9A5 baseline and differential
GenevisibleiQ9H9A5 HS

Family and domain databases

Gene3Di1.25.40.10, 2 hits
InterProiView protein in InterPro
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
SMARTiView protein in SMART
SM00028 TPR, 4 hits
SUPFAMiSSF48452 SSF48452, 8 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCNO10_HUMAN
AccessioniPrimary (citable) accession number: Q9H9A5
Secondary accession number(s): B7Z7L1
, F8WAF2, Q9BU30, Q9H5J7, Q9H8X1, Q9H9W0, Q9HAH3, Q9UFJ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: March 1, 2001
Last modified: September 12, 2018
This is version 155 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again