Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (13 Nov 2019)
Sequence version 3 (04 Nov 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Synaptopodin 2-like protein

Gene

SYNPO2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Actin-associated protein that may play a role in modulating actin-based shape.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptopodin 2-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYNPO2L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23532 SYNPO2L

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H987

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000166317

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134889033

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H987

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SYNPO2L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
212276492

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001876751 – 977Synaptopodin 2-like proteinAdd BLAST977

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei108PhosphoserineBy similarity1
Modified residuei111PhosphoserineBy similarity1
Modified residuei141PhosphothreonineBy similarity1
Modified residuei143PhosphoserineBy similarity1
Modified residuei178PhosphoserineBy similarity1
Modified residuei180PhosphoserineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei350PhosphoserineBy similarity1
Modified residuei374PhosphoserineBy similarity1
Modified residuei381PhosphoserineBy similarity1
Modified residuei384PhosphoserineBy similarity1
Modified residuei386Omega-N-methylarginineBy similarity1
Modified residuei466Omega-N-methylarginineBy similarity1
Modified residuei469Omega-N-methylarginineBy similarity1
Modified residuei479Omega-N-methylarginineBy similarity1
Modified residuei670PhosphoserineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei705PhosphothreonineBy similarity1
Modified residuei713PhosphothreonineBy similarity1
Modified residuei757Omega-N-methylarginineBy similarity1
Modified residuei788PhosphoserineBy similarity1
Modified residuei790PhosphoserineBy similarity1
Modified residuei792PhosphothreonineBy similarity1
Modified residuei806Omega-N-methylarginineBy similarity1
Modified residuei826Omega-N-methylarginineBy similarity1
Modified residuei889Omega-N-methylarginineBy similarity1
Modified residuei891PhosphoserineBy similarity1
Modified residuei892PhosphothreonineBy similarity1
Modified residuei898PhosphothreonineBy similarity1
Modified residuei910Omega-N-methylarginineBy similarity1
Modified residuei921Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei921Omega-N-methylarginine; alternateBy similarity1
Modified residuei955Omega-N-methylarginineBy similarity1
Modified residuei957Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H987

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H987

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H987

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H987

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H987

PeptideAtlas

More...
PeptideAtlasi
Q9H987

PRoteomics IDEntifications database

More...
PRIDEi
Q9H987

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81295 [Q9H987-1]
81296 [Q9H987-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H987

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H987

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166317 Expressed in 111 organ(s), highest expression level in cardiac ventricle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H987 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H987 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA055192
HPA057142

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9H987, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9H987

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378289

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H987

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 88PDZPROSITE-ProRule annotationAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi92 – 241Pro-richAdd BLAST150
Compositional biasi422 – 939Pro-richAdd BLAST518

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the synaptopodin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGPE Eukaryota
ENOG410ZJ02 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183054

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000261625

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H987

Identification of Orthologs from Complete Genome Data

More...
OMAi
EAMLLPH

Database of Orthologous Groups

More...
OrthoDBi
109454at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H987

TreeFam database of animal gene trees

More...
TreeFami
TF330867

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H987-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAEEEVLVT LSGGAPWGFR LHGGAEQRKP LQVSKIRRRS QAGRAGLRER
60 70 80 90 100
DQLLAINGVS CTNLSHASAM SLIDASGNQL VLTVQRLADE GPVQSPSPHE
110 120 130 140 150
LQVLSPLSPL SPEPPGAPVP QPLQPGSLRS PPDSEAYYGE TDSDADGPAT
160 170 180 190 200
QEKPRRPRRR GPTRPTPPGA PPDEVYLSDS PAEPAPTIPG PPSQGDSRVS
210 220 230 240 250
SPSWEDGAAL QPPPAEALLL PHGPLRPGPH LIPMVGPVPH PVAEDLTTTY
260 270 280 290 300
TQKAKQAKLQ RAESLQEKSI KEAKTKCRTI ASLLTAAPNP HSKGVLMFKK
310 320 330 340 350
RRQRAKKYTL VSFGAAAGTG AEEEDGVPPT SESELDEEAF SDARSLTNQS
360 370 380 390 400
DWDSPYLDME LARAGSRASE GQGSGLGGQL SEVSGRGVQL FEQQRQRADS
410 420 430 440 450
STQELARVEP AAMLNGEGLQ SPPRAQSAPP EAAVLPPSPL PAPVASPRPF
460 470 480 490 500
QPGGGAPTPA PSIFNRSARP FTPGLQGQRP TTTSVIFRPL APKRANDSLG
510 520 530 540 550
GLSPAPPPFL SSQGPTPLPS FTSGVPSHAP VSGSPSTPRS SGPVTATSSL
560 570 580 590 600
YIPAPSRPVT PGGAPEPPAP PSAAAMTSTA SIFLSAPLRP SARPEAPAPG
610 620 630 640 650
PGAPEPPSAR EQRISVPAAR TGILQEARRR GTRKQMFRPG KEETKNSPNP
660 670 680 690 700
ELLSLVQNLD EKPRAGGAES GPEEDALSLG AEACNFMQPV GARSYKTLPH
710 720 730 740 750
VTPKTPPPMA PKTPPPMTPK TPPPVAPKPP SRGLLDGLVN GAASSAGIPE
760 770 780 790 800
PPRLQGRGGE LFAKRQSRAD RYVVEGTPGP GLGPRPRSPS PTPSLPPSWK
810 820 830 840 850
YSPNIRAPPP IAYNPLLSPF FPQAARTLPK AQSQGPRATP KQGIKALDFM
860 870 880 890 900
RHQPYQLKTA MFCFDEVPPT PGPIASGSPK TARVQEIRRF STPAPQPTAE
910 920 930 940 950
PLAPTVLAPR AATTLDEPIW RTELASAPVP SPAPPPEAPR GLGASPSSCG
960 970
FQVARPRFSA TRTGLQAHVW RPGAGHQ
Note: No experimental confirmation available.
Length:977
Mass (Da):102,481
Last modified:November 4, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i885B28CEE3C5B3D7
GO
Isoform 2 (identifier: Q9H987-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-224: Missing.
     225-258: LRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAK → METFEPISQEPLSQASYDKAPDPVPELQDSFYAE

Show »
Length:753
Mass (Da):79,146
Checksum:i46F0797C216316B2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
U3KQD0U3KQD0_HUMAN
Synaptopodin 2-like protein
SYNPO2L
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti748I → T in BAB14346 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061835508P → H. Corresponds to variant dbSNP:rs57006992Ensembl.1
Natural variantiVAR_019671707P → L. Corresponds to variant dbSNP:rs3812629Ensembl.1
Natural variantiVAR_047065833S → Y. Corresponds to variant dbSNP:rs34163229Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0114951 – 224Missing in isoform 2. 2 PublicationsAdd BLAST224
Alternative sequenceiVSP_011496225 – 258LRPGP…AKQAK → METFEPISQEPLSQASYDKA PDPVPELQDSFYAE in isoform 2. 2 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB188489 mRNA Translation: BAD37139.1
AK022983 mRNA Translation: BAB14346.1
AC073389 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54507.1
BC142635 mRNA Translation: AAI42636.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44438.1 [Q9H987-1]
CCDS7331.1 [Q9H987-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001107605.1, NM_001114133.2 [Q9H987-1]
NP_079151.2, NM_024875.4 [Q9H987-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372873; ENSP00000361964; ENSG00000166317 [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317 [Q9H987-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79933

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79933

UCSC genome browser

More...
UCSCi
uc001jus.6 human [Q9H987-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB188489 mRNA Translation: BAD37139.1
AK022983 mRNA Translation: BAB14346.1
AC073389 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54507.1
BC142635 mRNA Translation: AAI42636.1
CCDSiCCDS44438.1 [Q9H987-1]
CCDS7331.1 [Q9H987-2]
RefSeqiNP_001107605.1, NM_001114133.2 [Q9H987-1]
NP_079151.2, NM_024875.4 [Q9H987-2]

3D structure databases

SMRiQ9H987
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ9H987, 8 interactors
MINTiQ9H987
STRINGi9606.ENSP00000378289

PTM databases

iPTMnetiQ9H987
PhosphoSitePlusiQ9H987

Polymorphism and mutation databases

BioMutaiSYNPO2L
DMDMi212276492

Proteomic databases

EPDiQ9H987
jPOSTiQ9H987
MassIVEiQ9H987
MaxQBiQ9H987
PaxDbiQ9H987
PeptideAtlasiQ9H987
PRIDEiQ9H987
ProteomicsDBi81295 [Q9H987-1]
81296 [Q9H987-2]

Genome annotation databases

EnsembliENST00000372873; ENSP00000361964; ENSG00000166317 [Q9H987-2]
ENST00000394810; ENSP00000378289; ENSG00000166317 [Q9H987-1]
GeneIDi79933
KEGGihsa:79933
UCSCiuc001jus.6 human [Q9H987-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79933

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SYNPO2L
HGNCiHGNC:23532 SYNPO2L
HPAiHPA055192
HPA057142
neXtProtiNX_Q9H987
OpenTargetsiENSG00000166317
PharmGKBiPA134889033

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGPE Eukaryota
ENOG410ZJ02 LUCA
GeneTreeiENSGT00950000183054
HOGENOMiHOG000261625
InParanoidiQ9H987
OMAiEAMLLPH
OrthoDBi109454at2759
PhylomeDBiQ9H987
TreeFamiTF330867

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SYNPO2L human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79933
PharosiQ9H987

Protein Ontology

More...
PROi
PR:Q9H987

Gene expression databases

BgeeiENSG00000166317 Expressed in 111 organ(s), highest expression level in cardiac ventricle
ExpressionAtlasiQ9H987 baseline and differential
GenevisibleiQ9H987 HS

Family and domain databases

InterProiView protein in InterPro
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYP2L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H987
Secondary accession number(s): A5PKV9, Q68A20
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: November 4, 2008
Last modified: November 13, 2019
This is version 138 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again