Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9H981 (ARP8_HUMAN)

Entry version 151 (11 Dec 2019)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Actin-related protein 8

Gene

ACTR8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.
Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Strongly prefer nucleosomes and H3-H4 tetramers over H2A-H2B dimers, suggesting it may act as a nucleosome recognition module within the complex.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei55ATP1
Binding sitei56ATP1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi283 – 286ATP4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, DNA damage, DNA recombination, DNA repair, Mitosis, Transcription, Transcription regulation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5689603 UCH proteinases
R-HSA-5696394 DNA Damage Recognition in GG-NER

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9H981

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-related protein 8
Short name:
hArp8
Alternative name(s):
INO80 complex subunit N
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACTR8
Synonyms:ARP8, INO80N
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000113812.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:14672 ACTR8

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9H981

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		93973

Open Targets

More...OpenTargetsi		ENSG00000113812

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24491

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9H981 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ACTR8

Domain mapping of disease mutations (DMDM)

More...DMDMi		116241257

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000891231 – 624Actin-related protein 8Add BLAST624

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei132PhosphoserineCombined sources1
Modified residuei412PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9H981

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9H981

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9H981

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9H981

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9H981

PeptideAtlas

More...PeptideAtlasi		Q9H981

PRoteomics IDEntifications database

More...PRIDEi		Q9H981

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		81292 [Q9H981-1]
81293 [Q9H981-2]
81294 [Q9H981-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9H981

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9H981

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000113812 Expressed in 192 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9H981 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9H981 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA065236

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the DBINO domain of INO80.

Interacts with ACTR5; the interaction is observed in asynchronous (interphase) cells but not in metaphase-arrested cells indicative for a possible dissociation of the INO80 complex in mitotic cells. Exists as monomers and dimers, but the dimer is most probably the biologically relevant form required for stable interactions with histones that exploits the twofold symmetry of the nucleosome core.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		125062, 42 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-846 INO80 chromatin remodeling complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9H981

Protein interaction database and analysis system

More...IntActi		Q9H981, 23 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000336842

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9H981 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1624
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9H981

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the actin family. ARP8 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0797 Eukaryota
COG5277 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000001763

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000034073

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9H981

KEGG Orthology (KO)

More...KOi		K11673

Identification of Orthologs from Complete Genome Data

More...OMAi		AQKTSIC

Database of Orthologous Groups

More...OrthoDBi		1258783at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9H981

TreeFam database of animal gene trees

More...TreeFami		TF324575

Family and domain databases

Database of protein disorder

More...DisProti		DP00873

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004000 Actin
IPR027668 Arp8/plant_Arp9

The PANTHER Classification System

More...PANTHERi		PTHR11937 PTHR11937, 1 hit
PTHR11937:SF13 PTHR11937:SF13, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00022 Actin, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00268 ACTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H981-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTQAEKGDTE NGKEKGGEKE KEQRGVKRPI VPALVPESLQ EQIQSNFIIV 
        60         70         80         90        100
IHPGSTTLRI GRATDTLPAS IPHVIARRHK QQGQPLYKDS WLLREGLNKP 
       110        120        130        140        150
ESNEQRQNGL KMVDQAIWSK KMSNGTRRIP VSPEQARSYN KQMRPAILDH 
       160        170        180        190        200
CSGNKWTNTS HHPEYLVGEE ALYVNPLDCY NIHWPIRRGQ LNIHPGPGGS 
       210        220        230        240        250
LTAVLADIEV IWSHAIQKYL EIPLKDLKYY RCILLIPDIY NKQHVKELVN 
       260        270        280        290        300
MILMKMGFSG IVVHQESVCA TYGSGLSSTC IVDVGDQKTS VCCVEDGVSH 
       310        320        330        340        350
RNTRLCLAYG GSDVSRCFYW LMQRAGFPYR ECQLTNKMDC LLLQHLKETF 
       360        370        380        390        400
CHLDQDISGL QDHEFQIRHP DSPALLYQFR LGDEKLQAPM ALFYPATFGI 
       410        420        430        440        450
VGQKMTTLQH RSQGDPEDPH DEHYLLATQS KQEQSAKATA DRKSASKPIG 
       460        470        480        490        500
FEGDLRGQSS DLPERLHSQE VDLGSAQGDG LMAGNDSEEA LTALMSRKTA 
       510        520        530        540        550
ISLFEGKALG LDKAILHSID CCSSDDTKKK MYSSILVVGG GLMFHKAQEF 
       560        570        580        590        600
LQHRILNKMP PSFRRIIENV DVITRPKDMD PRLIAWKGGA VLACLDTTQE 
       610        620 
LWIYQREWQR FGVRMLRERA AFVW
Length:624
Mass (Da):70,484
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDA71C49B9D2C4E19
GO
Isoform 2 (identifier: Q9H981-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-111: Missing.

Show »
Length:513
Mass (Da):58,045
Checksum:i601862886A522A00
GO
Isoform 3 (identifier: Q9H981-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-250: Missing.
     305-354: LCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLD → IFSWN

Show »
Length:329
Mass (Da):36,737
Checksum:i5A83E55423F44021
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y849H0Y849_HUMAN
Actin-related protein 8
ACTR8
378Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7L6C9J7L6_HUMAN
Actin-related protein 8
ACTR8
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15402 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti596D → G in BAB14352 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02803356T → I. Corresponds to variant dbSNP:rs3733082Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0405061 – 250Missing in isoform 3. 1 PublicationAdd BLAST250
Alternative sequenceiVSP_0405071 – 111Missing in isoform 2. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_040508305 – 354LCLAY…FCHLD → IFSWN in isoform 3. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK022996 mRNA Translation: BAB14352.1
AK094507 mRNA Translation: BAG52879.1
AK026232 mRNA Translation: BAB15402.1 Different initiation.
AC012467 Genomic DNA No translation available.
BC032744 mRNA Translation: AAH32744.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2875.1 [Q9H981-1]

NCBI Reference Sequences

More...RefSeqi		NP_075050.3, NM_022899.4 [Q9H981-1]
XP_005265644.1, XM_005265587.4 [Q9H981-1]
XP_011532551.1, XM_011534249.2 [Q9H981-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000335754; ENSP00000336842; ENSG00000113812 [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812 [Q9H981-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		93973

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:93973

UCSC genome browser

More...UCSCi		uc003dhc.5 human [Q9H981-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022996 mRNA Translation: BAB14352.1
AK094507 mRNA Translation: BAG52879.1
AK026232 mRNA Translation: BAB15402.1 Different initiation.
AC012467 Genomic DNA No translation available.
BC032744 mRNA Translation: AAH32744.1
CCDSiCCDS2875.1 [Q9H981-1]
RefSeqiNP_075050.3, NM_022899.4 [Q9H981-1]
XP_005265644.1, XM_005265587.4 [Q9H981-1]
XP_011532551.1, XM_011534249.2 [Q9H981-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4FO0X-ray2.60A34-624[»]
SMRiQ9H981
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi125062, 42 interactors
ComplexPortaliCPX-846 INO80 chromatin remodeling complex
CORUMiQ9H981
IntActiQ9H981, 23 interactors
STRINGi9606.ENSP00000336842

PTM databases

iPTMnetiQ9H981
PhosphoSitePlusiQ9H981

Polymorphism and mutation databases

BioMutaiACTR8
DMDMi116241257

Proteomic databases

EPDiQ9H981
jPOSTiQ9H981
MassIVEiQ9H981
MaxQBiQ9H981
PaxDbiQ9H981
PeptideAtlasiQ9H981
PRIDEiQ9H981
ProteomicsDBi81292 [Q9H981-1]
81293 [Q9H981-2]
81294 [Q9H981-3]

Genome annotation databases

EnsembliENST00000335754; ENSP00000336842; ENSG00000113812 [Q9H981-1]
ENST00000482349; ENSP00000419429; ENSG00000113812 [Q9H981-2]
GeneIDi93973
KEGGihsa:93973
UCSCiuc003dhc.5 human [Q9H981-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		93973
DisGeNETi93973
EuPathDBiHostDB:ENSG00000113812.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		ACTR8
HGNCiHGNC:14672 ACTR8
HPAiHPA065236
neXtProtiNX_Q9H981
OpenTargetsiENSG00000113812
PharmGKBiPA24491

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0797 Eukaryota
COG5277 LUCA
GeneTreeiENSGT00390000001763
HOGENOMiHOG000034073
InParanoidiQ9H981
KOiK11673
OMAiAQKTSIC
OrthoDBi1258783at2759
PhylomeDBiQ9H981
TreeFamiTF324575

Enzyme and pathway databases

ReactomeiR-HSA-5689603 UCH proteinases
R-HSA-5696394 DNA Damage Recognition in GG-NER
SignaLinkiQ9H981

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ACTR8 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		93973
PharosiQ9H981 Tdark

Protein Ontology

More...PROi		PR:Q9H981
RNActiQ9H981 protein

Gene expression databases

BgeeiENSG00000113812 Expressed in 192 organ(s), highest expression level in testis
ExpressionAtlasiQ9H981 baseline and differential
GenevisibleiQ9H981 HS

Family and domain databases

DisProtiDP00873
InterProiView protein in InterPro
IPR004000 Actin
IPR027668 Arp8/plant_Arp9
PANTHERiPTHR11937 PTHR11937, 1 hit
PTHR11937:SF13 PTHR11937:SF13, 1 hit
PfamiView protein in Pfam
PF00022 Actin, 2 hits
SMARTiView protein in SMART
SM00268 ACTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARP8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H981
Secondary accession number(s): B3KSW7, Q8N566, Q9H663
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 27, 2003
Last sequence update: October 17, 2006
Last modified: December 11, 2019
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again