Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 665

Gene

ZNF665

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri113 – 135C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri141 – 163C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri169 – 191C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri477 – 499C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri505 – 527C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri533 – 555C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri561 – 583C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri589 – 611C2H2-type 18PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 665
Alternative name(s):
Zinc finger protein 160-like
Gene namesi
Name:ZNF665
Synonyms:ZFP160L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000197497.10
HGNCiHGNC:25885 ZNF665
neXtProtiNX_Q9H7R5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000197497

Polymorphism and mutation databases

BioMutaiZNF665
DMDMi325511370

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003256131 – 613Zinc finger protein 665Add BLAST613

Proteomic databases

PaxDbiQ9H7R5
PeptideAtlasiQ9H7R5
PRIDEiQ9H7R5
ProteomicsDBi81141
81142 [Q9H7R5-2]

PTM databases

iPTMnetiQ9H7R5
PhosphoSitePlusiQ9H7R5

Expressioni

Gene expression databases

BgeeiENSG00000197497
CleanExiHS_ZNF665
GenevisibleiQ9H7R5 HS

Organism-specific databases

HPAiHPA023437

Interactioni

Protein-protein interaction databases

IntActiQ9H7R5, 2 interactors
STRINGi9606.ENSP00000379702

Structurei

3D structure databases

ProteinModelPortaliQ9H7R5
SMRiQ9H7R5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri113 – 135C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri141 – 163C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri169 – 191C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri197 – 219C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri225 – 247C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri253 – 275C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri281 – 303C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri309 – 331C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri337 – 359C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri365 – 387C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri393 – 415C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri421 – 443C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri449 – 471C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri477 – 499C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri505 – 527C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri533 – 555C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri561 – 583C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri589 – 611C2H2-type 18PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00920000148943
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ9H7R5
KOiK09228
OMAiVQKNTYD
OrthoDBiEOG091G02KC
PhylomeDBiQ9H7R5
TreeFamiTF341892

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 18 hits
SUPFAMiSSF57667 SSF57667, 10 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 18 hits
PS50157 ZINC_FINGER_C2H2_2, 18 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H7R5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEAFYTVKL ERLESCDTVG LSFQEVQKNT YDFECQWKDD EGNYKTVLML
60 70 80 90 100
QKENLPGRRA QRDRRAAGNR HIENQLGVSF QSHLPELQQF QHEGKIYEYN
110 120 130 140 150
QVEKSPNNRG KHYKCDECGK VFSQNSRLTS HKRIHTGEKP YQCNKCGKAF
160 170 180 190 200
TVRSNLTIHQ VIHTGEKPYK CNECGKVFSQ PSNLAGHQRI HTGEKPYKCN
210 220 230 240 250
ECGKAFRAHS KLTTHQVIHT GEKPYKCKEC GKCFTQNSHL ASHRRIHTGE
260 270 280 290 300
KPYKCNECGK AFSVRSSLTT HQTIHTGEKP YKCNECGKVF RHNSYLAKHR
310 320 330 340 350
RIHTGEKPYK CNECGKAFSM HSNLTKHQII HTGEKPFKCN ECVKVFTQYS
360 370 380 390 400
HLANHRRIHT GEKPYRCDEC GKAFSVRSSL TTHQAIHTGE KPYKCNDCGK
410 420 430 440 450
VFTQNSHLAS HRGIHSGEKP YKCDECGKAF SQTSQLARHW RVHTGEKPYK
460 470 480 490 500
CNECGKAFSV HSSLTIHQTI HTGQKPYKCN DCGKVFRHNS YLAIHQRIHT
510 520 530 540 550
GEKPYKCNEC GKAFSVHSNL ATHQVIHTGE KPYKCNECGK VFTQNSHLAN
560 570 580 590 600
HRRIHTGEKP YRCNECGKAF SVRSTLTTHM AVHTGDKPYK CNQCGKVFTQ
610
NSNLAKHRRI HSG
Length:613
Mass (Da):70,223
Last modified:March 8, 2011 - v2
Checksum:iDE5251006FCD0D2B
GO
Isoform 2 (identifier: Q9H7R5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MALPQGQLTFKDVAIEFSQEEWTCLDPAQKTLYRDVMLENYRNLVSLDISCKCVNTDLPPKGKNNM

Show »
Length:678
Mass (Da):77,640
Checksum:i78B5CA3D3744F7B4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti354N → S in BAF84092 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03989519V → A1 PublicationCorresponds to variant dbSNP:rs12460170Ensembl.1
Natural variantiVAR_03989692H → R1 PublicationCorresponds to variant dbSNP:rs4801959Ensembl.1
Natural variantiVAR_039897582V → I1 PublicationCorresponds to variant dbSNP:rs4801958Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407511M → MALPQGQLTFKDVAIEFSQE EWTCLDPAQKTLYRDVMLEN YRNLVSLDISCKCVNTDLPP KGKNNM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024407 mRNA Translation: BAB14911.1
AK291403 mRNA Translation: BAF84092.1
AC010328 Genomic DNA No translation available.
CCDSiCCDS46169.1 [Q9H7R5-2]
RefSeqiNP_079009.3, NM_024733.3 [Q9H7R5-2]
XP_005259323.1, XM_005259266.4
UniGeneiHs.745230

Genome annotation databases

EnsembliENST00000396424; ENSP00000379702; ENSG00000197497 [Q9H7R5-2]
ENST00000600412; ENSP00000469154; ENSG00000197497 [Q9H7R5-1]
GeneIDi79788
KEGGihsa:79788
UCSCiuc010eqm.2 human [Q9H7R5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN665_HUMAN
AccessioniPrimary (citable) accession number: Q9H7R5
Secondary accession number(s): A8K5T8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 8, 2011
Last modified: July 18, 2018
This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health