Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (13 Feb 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

SH2 domain-containing protein 4A

Gene

SH2D4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits estrogen-induced cell proliferation by competing with PLCG for binding to ESR1, blocking the effect of estrogen on PLCG and repressing estrogen-induced proliferation. May play a role in T-cell development and function.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9H788

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH2 domain-containing protein 4A
Alternative name(s):
Protein SH(2)A
Protein phosphatase 1 regulatory subunit 38
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH2D4A
Synonyms:PPP1R38, SH2A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000104611.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26102 SH2D4A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614968 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H788

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
63898

Open Targets

More...
OpenTargetsi
ENSG00000104611

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134891945

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH2D4A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74725117

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002331331 – 454SH2 domain-containing protein 4AAdd BLAST454

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei118PhosphoserineBy similarity1
Modified residuei124PhosphoserineCombined sources1
Modified residuei261PhosphoserineCombined sources1
Modified residuei315PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H788

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H788

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H788

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H788

PeptideAtlas

More...
PeptideAtlasi
Q9H788

PRoteomics IDEntifications database

More...
PRIDEi
Q9H788

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81087
81088 [Q9H788-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H788

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H788

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Aberrantly expressed in some cancers.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000104611 Expressed in 188 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H788 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H788 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001871
HPA001919

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ESR1.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121977, 62 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9H788

Protein interaction database and analysis system

More...
IntActi
Q9H788, 80 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265807

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9H788

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H788

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini347 – 440SH2PROSITE-ProRule annotationAdd BLAST94

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi172 – 177Poly-Ser6

Keywords - Domaini

SH2 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEFY Eukaryota
ENOG410XPPJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157357

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000031527

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057918

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H788

KEGG Orthology (KO)

More...
KOi
K17577

Identification of Orthologs from Complete Genome Data

More...
OMAi
YGFHQKK

Database of Orthologous Groups

More...
OrthoDBi
782492at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H788

TreeFam database of animal gene trees

More...
TreeFami
TF336893

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000980 SH2
IPR036860 SH2_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00017 SH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50001 SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H788-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLKQILSEMY IDPDLLAELS EEQKQILFFK MREEQIRRWK EREAAMERKE
60 70 80 90 100
SLPVKPRPKK ENGKSVHWKL GADKEVWVWV MGEHHLDKPY DVLCNEIIAE
110 120 130 140 150
RARLKAEQEA EEPRKTHSEE FTNSLKTKSQ YHDLQAPDNQ QTKDIWKKVA
160 170 180 190 200
EKEELEQGSR PAPTLEEEKI RSLSSSSRNI QQMLADSINR MKAYAFHQKK
210 220 230 240 250
ESMKKKQDEE INQIEEERTK QICKSWKEDS EWQASLRKSK AADEKRRSLA
260 270 280 290 300
KQAREDYKRL SLGAQKGRGG ERLQSPLRVP QKPERPPLPP KPQFLNSGAY
310 320 330 340 350
PQKPLRNQGV VRTLSSSAQE DIIRWFKEEQ LPLRAGYQKT SDTIAPWFHG
360 370 380 390 400
ILTLKKANEL LLSTGMPGSF LIRVSERIKG YALSYLSEDG CKHFLIDASA
410 420 430 440 450
DAYSFLGVDQ LQHATLADLV EYHKEEPITS LGKELLLYPC GQQDQLPDYL

ELFE
Length:454
Mass (Da):52,727
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2FC21D4E07FDA922
GO
Isoform 2 (identifier: Q9H788-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MLKQILSEMYIDPDLLAELSEEQKQILFFKMREEQIRRWKEREAAMERKESLPVKPRPKK → MWRVIEPPCPGAPST

Note: No experimental confirmation available.
Show »
Length:409
Mass (Da):46,978
Checksum:iE7EE9D96502188B4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YAT1H0YAT1_HUMAN
SH2 domain-containing protein 4A
SH2D4A
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH67117 differs from that shown. Reason: Frameshift at position 392.Curated
The sequence AAO41715 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAO41715 differs from that shown. Reason: Erroneous termination at position 455. Translated as stop.Curated
The sequence BAB14935 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti95N → T in BAB14935 (PubMed:14702039).Curated1
Sequence conflicti179N → T in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti238K → R in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti253A → V in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti291K → E in BAB14935 (PubMed:14702039).Curated1
Sequence conflicti346P → S in AAO41715 (PubMed:12476414).Curated1
Sequence conflicti440C → R in BAB14935 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051350209E → G1 PublicationCorresponds to variant dbSNP:rs35647122Ensembl.1
Natural variantiVAR_026055216E → G1 PublicationCorresponds to variant dbSNP:rs4921637Ensembl.1
Natural variantiVAR_026056263G → A1 PublicationCorresponds to variant dbSNP:rs877386Ensembl.1
Natural variantiVAR_051351275S → N1 PublicationCorresponds to variant dbSNP:rs34608771Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0427841 – 60MLKQI…PRPKK → MWRVIEPPCPGAPST in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024620 mRNA Translation: BAB14935.1 Different initiation.
AK024799 mRNA Translation: BAB15010.1
AK293301 mRNA Translation: BAG56822.1
AC068880 Genomic DNA No translation available.
BC014525 mRNA Translation: AAH14525.2
BC067117 mRNA Translation: AAH67117.1 Frameshift.
BC082982 mRNA Translation: AAH82982.1
AY190323 mRNA Translation: AAO41715.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55206.1 [Q9H788-2]
CCDS6009.1 [Q9H788-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001167630.1, NM_001174159.1 [Q9H788-1]
NP_001167631.1, NM_001174160.1 [Q9H788-2]
NP_071354.2, NM_022071.3 [Q9H788-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.303208

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265807; ENSP00000265807; ENSG00000104611 [Q9H788-1]
ENST00000518040; ENSP00000429482; ENSG00000104611 [Q9H788-2]
ENST00000519207; ENSP00000428684; ENSG00000104611 [Q9H788-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
63898

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:63898

UCSC genome browser

More...
UCSCi
uc003wzb.4 human [Q9H788-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024620 mRNA Translation: BAB14935.1 Different initiation.
AK024799 mRNA Translation: BAB15010.1
AK293301 mRNA Translation: BAG56822.1
AC068880 Genomic DNA No translation available.
BC014525 mRNA Translation: AAH14525.2
BC067117 mRNA Translation: AAH67117.1 Frameshift.
BC082982 mRNA Translation: AAH82982.1
AY190323 mRNA Translation: AAO41715.1 Sequence problems.
CCDSiCCDS55206.1 [Q9H788-2]
CCDS6009.1 [Q9H788-1]
RefSeqiNP_001167630.1, NM_001174159.1 [Q9H788-1]
NP_001167631.1, NM_001174160.1 [Q9H788-2]
NP_071354.2, NM_022071.3 [Q9H788-1]
UniGeneiHs.303208

3D structure databases

ProteinModelPortaliQ9H788
SMRiQ9H788
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121977, 62 interactors
ELMiQ9H788
IntActiQ9H788, 80 interactors
STRINGi9606.ENSP00000265807

PTM databases

iPTMnetiQ9H788
PhosphoSitePlusiQ9H788

Polymorphism and mutation databases

BioMutaiSH2D4A
DMDMi74725117

Proteomic databases

EPDiQ9H788
jPOSTiQ9H788
MaxQBiQ9H788
PaxDbiQ9H788
PeptideAtlasiQ9H788
PRIDEiQ9H788
ProteomicsDBi81087
81088 [Q9H788-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265807; ENSP00000265807; ENSG00000104611 [Q9H788-1]
ENST00000518040; ENSP00000429482; ENSG00000104611 [Q9H788-2]
ENST00000519207; ENSP00000428684; ENSG00000104611 [Q9H788-1]
GeneIDi63898
KEGGihsa:63898
UCSCiuc003wzb.4 human [Q9H788-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
63898
DisGeNETi63898
EuPathDBiHostDB:ENSG00000104611.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH2D4A
HGNCiHGNC:26102 SH2D4A
HPAiHPA001871
HPA001919
MIMi614968 gene
neXtProtiNX_Q9H788
OpenTargetsiENSG00000104611
PharmGKBiPA134891945

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEFY Eukaryota
ENOG410XPPJ LUCA
GeneTreeiENSGT00940000157357
HOGENOMiHOG000031527
HOVERGENiHBG057918
InParanoidiQ9H788
KOiK17577
OMAiYGFHQKK
OrthoDBi782492at2759
PhylomeDBiQ9H788
TreeFamiTF336893

Enzyme and pathway databases

SignaLinkiQ9H788

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH2D4A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SH2D4A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
63898

Protein Ontology

More...
PROi
PR:Q9H788

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000104611 Expressed in 188 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ9H788 baseline and differential
GenevisibleiQ9H788 HS

Family and domain databases

Gene3Di3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR000980 SH2
IPR036860 SH2_dom_sf
PfamiView protein in Pfam
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00252 SH2, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001 SH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH24A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H788
Secondary accession number(s): B4DDR1
, Q5XKC1, Q6NXE9, Q86YM2, Q96C88, Q9H7F7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2001
Last modified: February 13, 2019
This is version 149 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again