Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ domain-containing protein MAGIX

Gene

MAGIX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ domain-containing protein MAGIX
Gene namesi
Name:MAGIX
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000269313.5
HGNCiHGNC:30006 MAGIX
neXtProtiNX_Q9H6Y5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000269313
PharmGKBiPA162394882

Polymorphism and mutation databases

DMDMi209572736

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003105421 – 334PDZ domain-containing protein MAGIXAdd BLAST334

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei272PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9H6Y5
PeptideAtlasiQ9H6Y5
PRIDEiQ9H6Y5
ProteomicsDBi81059
81060 [Q9H6Y5-2]
81061 [Q9H6Y5-3]

PTM databases

iPTMnetiQ9H6Y5
PhosphoSitePlusiQ9H6Y5

Expressioni

Gene expression databases

BgeeiENSG00000269313 Expressed in 110 organ(s), highest expression level in right lobe of liver
CleanExiHS_MAGIX

Organism-specific databases

HPAiHPA035302

Interactioni

Protein-protein interaction databases

BioGridi122995, 23 interactors
STRINGi9606.ENSP00000387928

Structurei

Secondary structure

1334
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9H6Y5
SMRiQ9H6Y5
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H6Y5

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini125 – 209PDZPROSITE-ProRule annotationAdd BLAST85

Phylogenomic databases

eggNOGiKOG3209 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00650000092997
HOGENOMiHOG000081783
HOVERGENiHBG108115
InParanoidiQ9H6Y5
OMAiPHATIVD
OrthoDBiEOG091G0GW9
PhylomeDBiQ9H6Y5
TreeFamiTF315536

Family and domain databases

InterProiView protein in InterPro
IPR030031 MAGIX
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR10316:SF5 PTHR10316:SF5, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H6Y5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPRTGDAAD PRGSRGGRGP SPLAGPSARQ LLARLDARPL AARAAVDVAA
60 70 80 90 100
LVRRAGATLR LRRKEAVSVL DSADIEVTDS RLPHATIVDH RPQHRWLETC
110 120 130 140 150
NAPPQLIQGK ARSAPKPSQA SGHFSVELVR GYAGFGLTLG GGRDVAGDTP
160 170 180 190 200
LAVRGLLKDG PAQRCGRLEV GDLVLHINGE STQGLTHAQA VERIRAGGPQ
210 220 230 240 250
LHLVIRRPLE THPGKPRGVG EPRKGVVPSW PDRSPDPGGP EVTGSRSSST
260 270 280 290 300
SLVQHPPSRT TLKKTRGSPE PSPEAAADGP TVSPPERRAE DPNDQIPGSP
310 320 330
GPWLVPSEER LSRALGVRGA AQLAQEMAAG RRRH
Length:334
Mass (Da):35,273
Last modified:March 28, 2018 - v4
Checksum:i29F4C19DE64AC790
GO
Isoform 2 (identifier: Q9H6Y5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGDAAD...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):29,420
Checksum:i10ABD36DCFFDC41E
GO
Isoform 3 (identifier: Q9H6Y5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGDAAD...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF
     227-231: Missing.

Show »
Length:270
Mass (Da):28,854
Checksum:iA245FB6358849E54
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A024QZ18A0A024QZ18_HUMAN
PDZ domain containing, X chromosome...
MAGIX FLJ21687, hCG_1640095
275Annotation score:
A0A087X263A0A087X263_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
253Annotation score:
A0A087WUY6A0A087WUY6_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
258Annotation score:
C9J123C9J123_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
143Annotation score:
A0A087X1L4A0A087X1L4_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
262Annotation score:
A0A087WW28A0A087WW28_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
40Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03707553R → H. Corresponds to variant dbSNP:rs5906744Ensembl.1
Natural variantiVAR_047035112R → H. Corresponds to variant dbSNP:rs5906744Ensembl.1
Natural variantiVAR_047036173L → V. Corresponds to variant dbSNP:rs5905720Ensembl.1
Natural variantiVAR_047037323L → F. Corresponds to variant dbSNP:rs4824462Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0293191 – 92MEPRT…VDHRP → MPLLWITGPRYHLILLSEAS CLRANYVHLCPLF in isoform 2 and isoform 3. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_029320227 – 231Missing in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884401 mRNA Translation: ABI63368.1
AK025340 mRNA Translation: BAB15115.1
AC231657 Genomic DNA No translation available.
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50691.1
CCDSiCCDS48106.1 [Q9H6Y5-1]
RefSeqiNP_001093151.2, NM_001099681.2
NP_001093152.2, NM_001099682.2
NP_079135.3, NM_024859.3 [Q9H6Y5-1]
XP_005278121.1, XM_005278064.4 [Q9H6Y5-2]
XP_005278122.1, XM_005278065.3 [Q9H6Y5-2]
XP_011542287.1, XM_011543985.2 [Q9H6Y5-2]
XP_011542288.1, XM_011543986.2 [Q9H6Y5-2]
XP_011542289.1, XM_011543987.2 [Q9H6Y5-2]
UniGeneiHs.193170

Genome annotation databases

EnsembliENST00000595224; ENSP00000471299; ENSG00000269313 [Q9H6Y5-1]
ENST00000616266; ENSP00000481198; ENSG00000269313 [Q9H6Y5-2]
GeneIDi79917
KEGGihsa:79917

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884401 mRNA Translation: ABI63368.1
AK025340 mRNA Translation: BAB15115.1
AC231657 Genomic DNA No translation available.
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50691.1
CCDSiCCDS48106.1 [Q9H6Y5-1]
RefSeqiNP_001093151.2, NM_001099681.2
NP_001093152.2, NM_001099682.2
NP_079135.3, NM_024859.3 [Q9H6Y5-1]
XP_005278121.1, XM_005278064.4 [Q9H6Y5-2]
XP_005278122.1, XM_005278065.3 [Q9H6Y5-2]
XP_011542287.1, XM_011543985.2 [Q9H6Y5-2]
XP_011542288.1, XM_011543986.2 [Q9H6Y5-2]
XP_011542289.1, XM_011543987.2 [Q9H6Y5-2]
UniGeneiHs.193170

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJTNMR-A119-209[»]
ProteinModelPortaliQ9H6Y5
SMRiQ9H6Y5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122995, 23 interactors
STRINGi9606.ENSP00000387928

PTM databases

iPTMnetiQ9H6Y5
PhosphoSitePlusiQ9H6Y5

Polymorphism and mutation databases

DMDMi209572736

Proteomic databases

PaxDbiQ9H6Y5
PeptideAtlasiQ9H6Y5
PRIDEiQ9H6Y5
ProteomicsDBi81059
81060 [Q9H6Y5-2]
81061 [Q9H6Y5-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000595224; ENSP00000471299; ENSG00000269313 [Q9H6Y5-1]
ENST00000616266; ENSP00000481198; ENSG00000269313 [Q9H6Y5-2]
GeneIDi79917
KEGGihsa:79917

Organism-specific databases

CTDi79917
EuPathDBiHostDB:ENSG00000269313.5
GeneCardsiMAGIX
HGNCiHGNC:30006 MAGIX
HPAiHPA035302
neXtProtiNX_Q9H6Y5
OpenTargetsiENSG00000269313
PharmGKBiPA162394882
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3209 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00650000092997
HOGENOMiHOG000081783
HOVERGENiHBG108115
InParanoidiQ9H6Y5
OMAiPHATIVD
OrthoDBiEOG091G0GW9
PhylomeDBiQ9H6Y5
TreeFamiTF315536

Miscellaneous databases

EvolutionaryTraceiQ9H6Y5
GenomeRNAii79917
PROiPR:Q9H6Y5

Gene expression databases

BgeeiENSG00000269313 Expressed in 110 organ(s), highest expression level in right lobe of liver
CleanExiHS_MAGIX

Family and domain databases

InterProiView protein in InterPro
IPR030031 MAGIX
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR10316:SF5 PTHR10316:SF5, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMAGIX_HUMAN
AccessioniPrimary (citable) accession number: Q9H6Y5
Secondary accession number(s): A0A075B7A2
, A6XND4, A8MSX9, B7WP26, Q14C81
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 28, 2018
Last modified: September 12, 2018
This is version 108 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again