Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (18 Sep 2019)
Sequence version 4 (28 Mar 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

PDZ domain-containing protein MAGIX

Gene

MAGIX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PDZ domain-containing protein MAGIX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAGIX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30006 MAGIX

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H6Y5

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79917

Open Targets

More...
OpenTargetsi
ENSG00000269313

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162394882

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H6Y5

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MAGIX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
209572736

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003105421 – 334PDZ domain-containing protein MAGIXAdd BLAST334

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei272PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H6Y5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H6Y5

PeptideAtlas

More...
PeptideAtlasi
Q9H6Y5

PRoteomics IDEntifications database

More...
PRIDEi
Q9H6Y5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81059 [Q9H6Y5-1]
81060 [Q9H6Y5-2]
81061 [Q9H6Y5-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H6Y5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H6Y5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000269313 Expressed in 110 organ(s), highest expression level in right lobe of liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H6Y5 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035302

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122995, 23 interactors

Protein interaction database and analysis system

More...
IntActi
Q9H6Y5, 23 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000471299

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1334
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H6Y5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9H6Y5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini125 – 209PDZPROSITE-ProRule annotationAdd BLAST85

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3209 Eukaryota
COG5021 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162529

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000081783

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H6Y5

Identification of Orthologs from Complete Genome Data

More...
OMAi
VDHRPQH

Database of Orthologous Groups

More...
OrthoDBi
284488at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H6Y5

TreeFam database of animal gene trees

More...
TreeFami
TF315536

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030031 MAGIX
IPR001478 PDZ
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR47646 PTHR47646, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H6Y5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPRTGDAAD PRGSRGGRGP SPLAGPSARQ LLARLDARPL AARAAVDVAA
60 70 80 90 100
LVRRAGATLR LRRKEAVSVL DSADIEVTDS RLPHATIVDH RPQHRWLETC
110 120 130 140 150
NAPPQLIQGK ARSAPKPSQA SGHFSVELVR GYAGFGLTLG GGRDVAGDTP
160 170 180 190 200
LAVRGLLKDG PAQRCGRLEV GDLVLHINGE STQGLTHAQA VERIRAGGPQ
210 220 230 240 250
LHLVIRRPLE THPGKPRGVG EPRKGVVPSW PDRSPDPGGP EVTGSRSSST
260 270 280 290 300
SLVQHPPSRT TLKKTRGSPE PSPEAAADGP TVSPPERRAE DPNDQIPGSP
310 320 330
GPWLVPSEER LSRALGVRGA AQLAQEMAAG RRRH
Length:334
Mass (Da):35,273
Last modified:March 28, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i29F4C19DE64AC790
GO
Isoform 2 (identifier: Q9H6Y5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGDAAD...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF

Note: No experimental confirmation available.
Show »
Length:275
Mass (Da):29,420
Checksum:i10ABD36DCFFDC41E
GO
Isoform 3 (identifier: Q9H6Y5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MEPRTGDAAD...PHATIVDHRP → MPLLWITGPRYHLILLSEASCLRANYVHLCPLF
     227-231: Missing.

Show »
Length:270
Mass (Da):28,854
Checksum:iA245FB6358849E54
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X263A0A087X263_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUY6A0A087WUY6_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J123C9J123_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X1L4A0A087X1L4_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
262Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WW28A0A087WW28_HUMAN
PDZ domain-containing protein MAGIX
MAGIX
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03707553R → H. Corresponds to variant dbSNP:rs5906744Ensembl.1
Natural variantiVAR_047035112R → H. Corresponds to variant dbSNP:rs5906744Ensembl.1
Natural variantiVAR_047036173L → V. Corresponds to variant dbSNP:rs5905720Ensembl.1
Natural variantiVAR_047037323L → F. Corresponds to variant dbSNP:rs4824462Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0293191 – 92MEPRT…VDHRP → MPLLWITGPRYHLILLSEAS CLRANYVHLCPLF in isoform 2 and isoform 3. 2 PublicationsAdd BLAST92
Alternative sequenceiVSP_029320227 – 231Missing in isoform 3. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ884401 mRNA Translation: ABI63368.1
AK025340 mRNA Translation: BAB15115.1
AC231657 Genomic DNA No translation available.
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50691.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48106.1 [Q9H6Y5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001093151.2, NM_001099681.2
NP_001093152.2, NM_001099682.2
NP_079135.3, NM_024859.3 [Q9H6Y5-1]
XP_005278121.1, XM_005278064.4 [Q9H6Y5-2]
XP_005278122.1, XM_005278065.3 [Q9H6Y5-2]
XP_011542287.1, XM_011543985.2 [Q9H6Y5-2]
XP_011542288.1, XM_011543986.2 [Q9H6Y5-2]
XP_011542289.1, XM_011543987.2 [Q9H6Y5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000595224; ENSP00000471299; ENSG00000269313 [Q9H6Y5-1]
ENST00000616266; ENSP00000481198; ENSG00000269313 [Q9H6Y5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79917

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79917

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ884401 mRNA Translation: ABI63368.1
AK025340 mRNA Translation: BAB15115.1
AC231657 Genomic DNA No translation available.
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50691.1
CCDSiCCDS48106.1 [Q9H6Y5-1]
RefSeqiNP_001093151.2, NM_001099681.2
NP_001093152.2, NM_001099682.2
NP_079135.3, NM_024859.3 [Q9H6Y5-1]
XP_005278121.1, XM_005278064.4 [Q9H6Y5-2]
XP_005278122.1, XM_005278065.3 [Q9H6Y5-2]
XP_011542287.1, XM_011543985.2 [Q9H6Y5-2]
XP_011542288.1, XM_011543986.2 [Q9H6Y5-2]
XP_011542289.1, XM_011543987.2 [Q9H6Y5-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJTNMR-A119-209[»]
SMRiQ9H6Y5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi122995, 23 interactors
IntActiQ9H6Y5, 23 interactors
STRINGi9606.ENSP00000471299

PTM databases

iPTMnetiQ9H6Y5
PhosphoSitePlusiQ9H6Y5

Polymorphism and mutation databases

BioMutaiMAGIX
DMDMi209572736

Proteomic databases

MassIVEiQ9H6Y5
PaxDbiQ9H6Y5
PeptideAtlasiQ9H6Y5
PRIDEiQ9H6Y5
ProteomicsDBi81059 [Q9H6Y5-1]
81060 [Q9H6Y5-2]
81061 [Q9H6Y5-3]

Genome annotation databases

EnsembliENST00000595224; ENSP00000471299; ENSG00000269313 [Q9H6Y5-1]
ENST00000616266; ENSP00000481198; ENSG00000269313 [Q9H6Y5-2]
GeneIDi79917
KEGGihsa:79917

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79917
DisGeNETi79917

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAGIX
HGNCiHGNC:30006 MAGIX
HPAiHPA035302
neXtProtiNX_Q9H6Y5
OpenTargetsiENSG00000269313
PharmGKBiPA162394882

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3209 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00940000162529
HOGENOMiHOG000081783
InParanoidiQ9H6Y5
OMAiVDHRPQH
OrthoDBi284488at2759
PhylomeDBiQ9H6Y5
TreeFamiTF315536

Miscellaneous databases

EvolutionaryTraceiQ9H6Y5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79917
PharosiQ9H6Y5

Protein Ontology

More...
PROi
PR:Q9H6Y5

Gene expression databases

BgeeiENSG00000269313 Expressed in 110 organ(s), highest expression level in right lobe of liver
ExpressionAtlasiQ9H6Y5 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR030031 MAGIX
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR47646 PTHR47646, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAGIX_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H6Y5
Secondary accession number(s): A0A075B7A2
, A6XND4, A8MSX9, B7WP26, Q14C81
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: March 28, 2018
Last modified: September 18, 2019
This is version 116 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again