Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9H6X2 (ANTR1_HUMAN)

Entry version 196 (02 Dec 2020)
Sequence version 2 (02 Nov 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Anthrax toxin receptor 1

Gene

ANTXR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi52Divalent metal cationBy similarity1
Metal bindingi54Divalent metal cationBy similarity1
Metal bindingi118Divalent metal cationBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
LigandMetal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9H6X2

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5210891, Uptake and function of anthrax toxins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anthrax toxin receptor 1
Alternative name(s):
Tumor endothelial marker 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANTXR1
Synonyms:ATR, TEM8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000169604.19

Human Gene Nomenclature Database

More...HGNCi		HGNC:21014, ANTXR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606410, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9H6X2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini33 – 321ExtracellularSequence analysisAdd BLAST289
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei322 – 342HelicalSequence analysisAdd BLAST21
Topological domaini343 – 564CytoplasmicSequence analysisAdd BLAST222

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hemangioma, capillary infantile (HCI)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA condition characterized by dull red, firm, dome-shaped hemangiomas, sharply demarcated from surrounding skin, usually presenting at birth or occurring within the first two or three months of life. They result from highly proliferative, localized growth of capillary endothelium and generally undergo regression and involution without scarring.
Related information in OMIM
GAPO syndrome (GAPOS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disease characterized by growth retardation, alopecia, failure of tooth eruption, and progressive optic atrophy in some patients.
Related information in OMIM

Keywords - Diseasei

Hypotrichosis

Organism-specific databases

DisGeNET

More...DisGeNETi		84168

MalaCards human disease database

More...MalaCardsi		ANTXR1
MIMi230740, phenotype
602089, phenotype

Open Targets

More...OpenTargetsi		ENSG00000169604

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2067, GAPO syndrome
464293, NON RARE IN EUROPE: Infantile capillary hemangioma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134956382

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9H6X2, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB05945, MDX-1303

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ANTXR1

Domain mapping of disease mutations (DMDM)

More...DMDMi		17366074

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 32Sequence analysisAdd BLAST32
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000269233 – 564Anthrax toxin receptor 1Add BLAST532

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi39 ↔ 2201 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi166N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi184N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi262N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei362PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9H6X2

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9H6X2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9H6X2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9H6X2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9H6X2

PeptideAtlas

More...PeptideAtlasi		Q9H6X2

PRoteomics IDEntifications database

More...PRIDEi		Q9H6X2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		81048 [Q9H6X2-1]
81049 [Q9H6X2-2]
81050 [Q9H6X2-3]
81051 [Q9H6X2-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9H6X2, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9H6X2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9H6X2

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q9H6X2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in umbilical vein endothelial cells (at protein level). Highly expressed in tumor endothelial cells.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in cultured angiogenic umbilical vein endothelial cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000169604, Expressed in stromal cell of endometrium and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9H6X2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9H6X2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000169604, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with gelatin and type 1 collagen.

Interacts with the actin cytoskeleton. Binds to the protective antigen (PA) of Bacillus anthracis. Binding does not occur in the presence of calcium.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123924, 67 interactors

Protein interaction database and analysis system

More...IntActi		Q9H6X2, 51 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000301945

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9H6X2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1564
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9H6X2

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini44 – 215VWFAPROSITE-ProRule annotationAdd BLAST172

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni154 – 160Interaction with PA7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi360 – 368Asp/Glu-rich (highly acidic)9
Compositional biasi506 – 564Pro-richAdd BLAST59

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binding to PA occurs through the VWA domain.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATR family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QSKR, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156522

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_029760_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9H6X2

Identification of Orthologs from Complete Genome Data

More...OMAi		IYYENVH

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9H6X2

TreeFam database of animal gene trees

More...TreeFami		TF328943

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.50.410, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR017360, Anthrax_toxin_rcpt
IPR008399, Anthrax_toxin_rcpt_C
IPR008400, Anthrax_toxin_rcpt_extracel
IPR002035, VWF_A
IPR036465, vWFA_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR16059:SF11, PTHR16059:SF11, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05586, Ant_C, 1 hit
PF05587, Anth_Ig, 1 hit
PF00092, VWA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00327, VWA, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53300, SSF53300, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50234, VWFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H6X2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATAERRALG IGFQWLSLAT LVLICAGQGG RREDGGPACY GGFDLYFILD 
        60         70         80         90        100
KSGSVLHHWN EIYYFVEQLA HKFISPQLRM SFIVFSTRGT TLMKLTEDRE 
       110        120        130        140        150
QIRQGLEELQ KVLPGGDTYM HEGFERASEQ IYYENRQGYR TASVIIALTD 
       160        170        180        190        200
GELHEDLFFY SEREANRSRD LGAIVYCVGV KDFNETQLAR IADSKDHVFP 
       210        220        230        240        250
VNDGFQALQG IIHSILKKSC IEILAAEPST ICAGESFQVV VRGNGFRHAR 
       260        270        280        290        300
NVDRVLCSFK INDSVTLNEK PFSVEDTYLL CPAPILKEVG MKAALQVSMN 
       310        320        330        340        350
DGLSFISSSV IITTTHCSDG SILAIALLIL FLLLALALLW WFWPLCCTVI 
       360        370        380        390        400
IKEVPPPPAE ESEEEDDDGL PKKKWPTVDA SYYGGRGVGG IKRMEVRWGE 
       410        420        430        440        450
KGSTEEGAKL EKAKNARVKM PEQEYEFPEP RNLNNNMRRP SSPRKWYSPI 
       460        470        480        490        500
KGKLDALWVL LRKGYDRVSV MRPQPGDTGR CINFTRVKNN QPAKYPLNNA 
       510        520        530        540        550
YHTSSPPPAP IYTPPPPAPH CPPPPPSAPT PPIPSPPSTL PPPPQAPPPN 
       560 
RAPPPSRPPP RPSV
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:564
Mass (Da):62,789
Last modified:November 2, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB118A00AD5DF2233
GO
Isoform 2 (identifier: Q9H6X2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-368: EDDD → NKIK
     369-564: Missing.

Show »
Length:368
Mass (Da):41,157
Checksum:i8A87B13FFA7D8753
GO
Isoform 3 (identifier: Q9H6X2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     268-297: NEKPFSVEDTYLLCPAPILKEVGMKAALQV → SKSLQSPWVSSTSGFKEGNSHPCLPARPHT
     298-564: Missing.

Show »
Length:297
Mass (Da):33,280
Checksum:i96C8BB0E8EBB0C4A
GO
Isoform 4 (identifier: Q9H6X2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     319-333: DGSILAIALLILFLL → LHKIASGPTTAACME
     334-564: Missing.

Show »
Length:333
Mass (Da):37,055
Checksum:iF864586DEE043BBD
GO
Isoform 5 (identifier: Q9H6X2-5) [UniParc]FASTAAdd to basket
Also known as: V4

The sequence of this isoform differs from the canonical sequence as follows:
     522-557: Missing.

Show »
Length:528
Mass (Da):59,205
Checksum:i28EC6D35E381197C
GO
Isoform 6 (identifier: Q9H6X2-6) [UniParc]FASTAAdd to basket
Also known as: V5

The sequence of this isoform differs from the canonical sequence as follows:
     315-358: THCSDGSILA...VIIKEVPPPP → FHPSPSSPGS...LGSLRNFRRC
     359-564: Missing.

Note: Prostate-specific.Curated
Show »
Length:358
Mass (Da):39,742
Checksum:iA1297D22F092C512
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YC24H0YC24_HUMAN
Anthrax toxin receptor 1
ANTXR1
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91707 differs from that shown. Erroneous initiation (Translation N-terminally extended) due to a conflict with the genome, including a frameshift.Curated
The sequence BAB15128 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0530157R → K1 PublicationCorresponds to variant dbSNP:rs28365986Ensembl.1
Natural variantiVAR_063146326A → T in HCI susceptibility; expression of FLT1 in hemangioma endothelial cells is markedly reduced compared to controls; low FLT1 expression in hemangioma cells is caused by reduced activity of a pathway involving ITGB1, ANTXR1, KDR and NFATC2IP; the mutation disrupts interaction of these molecules in a dominant-negative manner. 1 PublicationCorresponds to variant dbSNP:rs119475040EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000446268 – 297NEKPF…AALQV → SKSLQSPWVSSTSGFKEGNS HPCLPARPHT in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_000447298 – 564Missing in isoform 3. 1 PublicationAdd BLAST267
Alternative sequenceiVSP_047863315 – 358THCSD…VPPPP → FHPSPSSPGSTSQQGTSSLP PSSKAFCLEPKVPALGSLRN FRRC in isoform 6. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_000448319 – 333DGSIL…ILFLL → LHKIASGPTTAACME in isoform 4. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_000449334 – 564Missing in isoform 4. 2 PublicationsAdd BLAST231
Alternative sequenceiVSP_047864359 – 564Missing in isoform 6. 1 PublicationAdd BLAST206
Alternative sequenceiVSP_000444365 – 368EDDD → NKIK in isoform 2. 1 Publication4
Alternative sequenceiVSP_000445369 – 564Missing in isoform 2. 1 PublicationAdd BLAST196
Alternative sequenceiVSP_047865522 – 557Missing in isoform 5. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF279145 mRNA Translation: AAK52094.1
AF421380 mRNA Translation: AAL26496.1
JX424838 mRNA Translation: AFQ94038.1
JX424839 mRNA Translation: AFQ94039.1
AK001463 mRNA Translation: BAA91707.1 Sequence problems.
AK025429 mRNA Translation: BAB15128.1 Different initiation.
AK292113 mRNA Translation: BAF84802.1
AC112230 Genomic DNA Translation: AAX88860.1
AC114802 Genomic DNA Translation: AAY24067.1
BC012074 mRNA Translation: AAH12074.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1892.1 [Q9H6X2-1]
CCDS46313.1 [Q9H6X2-2]
CCDS46314.1 [Q9H6X2-4]

NCBI Reference Sequences

More...RefSeqi		NP_060623.2, NM_018153.3 [Q9H6X2-4]
NP_115584.1, NM_032208.2 [Q9H6X2-1]
NP_444262.1, NM_053034.2 [Q9H6X2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000303714; ENSP00000301945; ENSG00000169604 [Q9H6X2-1]
ENST00000409349; ENSP00000386494; ENSG00000169604 [Q9H6X2-2]
ENST00000409829; ENSP00000387058; ENSG00000169604 [Q9H6X2-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84168

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84168

UCSC genome browser

More...UCSCi		uc002sfe.4, human [Q9H6X2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF279145 mRNA Translation: AAK52094.1
AF421380 mRNA Translation: AAL26496.1
JX424838 mRNA Translation: AFQ94038.1
JX424839 mRNA Translation: AFQ94039.1
AK001463 mRNA Translation: BAA91707.1 Sequence problems.
AK025429 mRNA Translation: BAB15128.1 Different initiation.
AK292113 mRNA Translation: BAF84802.1
AC112230 Genomic DNA Translation: AAX88860.1
AC114802 Genomic DNA Translation: AAY24067.1
BC012074 mRNA Translation: AAH12074.1
CCDSiCCDS1892.1 [Q9H6X2-1]
CCDS46313.1 [Q9H6X2-2]
CCDS46314.1 [Q9H6X2-4]
RefSeqiNP_060623.2, NM_018153.3 [Q9H6X2-4]
NP_115584.1, NM_032208.2 [Q9H6X2-1]
NP_444262.1, NM_053034.2 [Q9H6X2-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3N2NX-ray1.80A/B/C/D/E/F38-220[»]
6ADLelectron microscopy3.08R38-220[»]
6ADMelectron microscopy2.84R38-220[»]
6ADRelectron microscopy3.38R38-220[»]
6CX1electron microscopy3.80E39-220[»]
SMRiQ9H6X2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi123924, 67 interactors
IntActiQ9H6X2, 51 interactors
STRINGi9606.ENSP00000301945

Chemistry databases

DrugBankiDB05945, MDX-1303

PTM databases

GlyGeniQ9H6X2, 3 sites
iPTMnetiQ9H6X2
PhosphoSitePlusiQ9H6X2
SwissPalmiQ9H6X2

Polymorphism and mutation databases

BioMutaiANTXR1
DMDMi17366074

Proteomic databases

EPDiQ9H6X2
jPOSTiQ9H6X2
MassIVEiQ9H6X2
MaxQBiQ9H6X2
PaxDbiQ9H6X2
PeptideAtlasiQ9H6X2
PRIDEiQ9H6X2
ProteomicsDBi81048 [Q9H6X2-1]
81049 [Q9H6X2-2]
81050 [Q9H6X2-3]
81051 [Q9H6X2-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16201, 605 antibodies

The DNASU plasmid repository

More...DNASUi		84168

Genome annotation databases

EnsembliENST00000303714; ENSP00000301945; ENSG00000169604 [Q9H6X2-1]
ENST00000409349; ENSP00000386494; ENSG00000169604 [Q9H6X2-2]
ENST00000409829; ENSP00000387058; ENSG00000169604 [Q9H6X2-4]
GeneIDi84168
KEGGihsa:84168
UCSCiuc002sfe.4, human [Q9H6X2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84168
DisGeNETi84168
EuPathDBiHostDB:ENSG00000169604.19

GeneCards: human genes, protein and diseases

More...GeneCardsi		ANTXR1
HGNCiHGNC:21014, ANTXR1
HPAiENSG00000169604, Low tissue specificity
MalaCardsiANTXR1
MIMi230740, phenotype
602089, phenotype
606410, gene
neXtProtiNX_Q9H6X2
OpenTargetsiENSG00000169604
Orphaneti2067, GAPO syndrome
464293, NON RARE IN EUROPE: Infantile capillary hemangioma
PharmGKBiPA134956382

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QSKR, Eukaryota
GeneTreeiENSGT00940000156522
HOGENOMiCLU_029760_0_0_1
InParanoidiQ9H6X2
OMAiIYYENVH
PhylomeDBiQ9H6X2
TreeFamiTF328943

Enzyme and pathway databases

PathwayCommonsiQ9H6X2
ReactomeiR-HSA-5210891, Uptake and function of anthrax toxins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84168, 7 hits in 848 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ANTXR1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ANTXR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84168
PharosiQ9H6X2, Tbio

Protein Ontology

More...PROi		PR:Q9H6X2
RNActiQ9H6X2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000169604, Expressed in stromal cell of endometrium and 225 other tissues
ExpressionAtlasiQ9H6X2, baseline and differential
GenevisibleiQ9H6X2, HS

Family and domain databases

Gene3Di3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR017360, Anthrax_toxin_rcpt
IPR008399, Anthrax_toxin_rcpt_C
IPR008400, Anthrax_toxin_rcpt_extracel
IPR002035, VWF_A
IPR036465, vWFA_dom_sf
PANTHERiPTHR16059:SF11, PTHR16059:SF11, 1 hit
PfamiView protein in Pfam
PF05586, Ant_C, 1 hit
PF05587, Anth_Ig, 1 hit
PF00092, VWA, 1 hit
SMARTiView protein in SMART
SM00327, VWA, 1 hit
SUPFAMiSSF53300, SSF53300, 1 hit
PROSITEiView protein in PROSITE
PS50234, VWFA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANTR1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H6X2
Secondary accession number(s): A8K7U8
, J7K7G4, J7KF88, Q4ZFV6, Q53QD8, Q96P02, Q9NVP3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 2, 2001
Last sequence update: November 2, 2001
Last modified: December 2, 2020
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again