Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (07 Oct 2020)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Src-like-adapter 2

Gene

SLA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9H6Q3

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9H6Q3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9H6Q3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Src-like-adapter 2
Alternative name(s):
Modulator of antigen receptor signaling
Short name:
MARS
Src-like adapter protein 2
Short name:
SLAP-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLA2
Synonyms:C20orf156, SLAP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000101082.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17329, SLA2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606577, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H6Q3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi2G → A: Abolishes localization to membranes. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
84174

Open Targets

More...
OpenTargetsi
ENSG00000101082

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38231

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H6Q3, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLA2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
30173374

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000223512 – 261Src-like-adapter 2Add BLAST260

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CSF1R.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H6Q3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H6Q3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H6Q3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H6Q3

PeptideAtlas

More...
PeptideAtlasi
Q9H6Q3

PRoteomics IDEntifications database

More...
PRIDEi
Q9H6Q3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81005 [Q9H6Q3-1]
81006 [Q9H6Q3-2]
81007 [Q9H6Q3-3]
81008 [Q9H6Q3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H6Q3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H6Q3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in immune system, with highest levels in peripheral blood leukocytes. Expressed in spleen, thymus and lymph nodes. Expressed in T-cells as well as in monocytes, and at low level in B-cells. Also detected in placenta, prostate, skin, retina and colon.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101082, Expressed in blood and 127 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H6Q3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000101082, Tissue enhanced (blood, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via SH2 domain) with ZAP70 (phosphorylated) and CD3Z (phosphorylated).

Interacts (via SH2 domain) with CSF1R (phosphorylated) (By similarity).

Interacts (via its C-terminal domain) with CBL (phosphorylated).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123928, 16 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9H6Q3

Protein interaction database and analysis system

More...
IntActi
Q9H6Q3, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9H6Q3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262866

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H6Q3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1261
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H6Q3

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 92SH3PROSITE-ProRule annotationAdd BLAST61
Domaini94 – 191SH2PROSITE-ProRule annotationAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni195 – 261SLA C-terminalAdd BLAST67

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The loss of the C-terminal domain partially abolishes the inhibitory function, but can be partially compensated by higher level of protein expression.

Keywords - Domaini

SH2 domain, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QPJN, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160331

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_084503_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H6Q3

KEGG Orthology (KO)

More...
KOi
K23698

Identification of Orthologs from Complete Genome Data

More...
OMAi
KISHGWL

Database of Orthologous Groups

More...
OrthoDBi
1051480at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H6Q3

TreeFam database of animal gene trees

More...
TreeFami
TF354288

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10344, SH2_SLAP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR035054, SLAP2
IPR035052, SLAP_SH2

The PANTHER Classification System

More...
PANTHERi
PTHR10155:SF6, PTHR10155:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00017, SH2, 1 hit
PF00018, SH3_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401, SH2DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00252, SH2, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50001, SH2, 1 hit
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket
Isoform 1 (identifier: Q9H6Q3-1) [UniParc]FASTAAdd to basket
Also known as: p28

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSLPSRRKS LPSPSLSSSV QGQGPVTMEA ERSKATAVAL GSFPAGGPAE
60 70 80 90 100
LSLRLGEPLT IVSEDGDWWT VLSEVSGREY NIPSVHVAKV SHGWLYEGLS
110 120 130 140 150
REKAEELLLL PGNPGGAFLI RESQTRRGSY SLSVRLSRPA SWDRIRHYRI
160 170 180 190 200
HCLDNGWLYI SPRLTFPSLQ ALVDHYSELA DDICCLLKEP CVLQRAGPLP
210 220 230 240 250
GKDIPLPVTV QRTPLNWKEL DSSLLFSEAA TGEESLLSEG LRESLSFYIS
260
LNDEAVSLDD A
Length:261
Mass (Da):28,585
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i858AF03451672B3D
GO
Isoform 2 (identifier: Q9H6Q3-2) [UniParc]FASTAAdd to basket
Also known as: p23, SLAP-2-v, MARS-v

The sequence of this isoform differs from the canonical sequence as follows:
     179-210: LADDICCLLKEPCVLQRAGPLPGKDIPLPVTV → GWPAPWQGYTPTCDCAEDTTQLERAGQLPPVF
     211-261: Missing.

Show »
Length:210
Mass (Da):23,103
Checksum:iBED62208E53A472E
GO
Isoform 3 (identifier: Q9H6Q3-3) [UniParc]FASTAAdd to basket
Also known as: p25

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Note: Produced by alternative initiation at Met-28 of isoform 1.Curated
Show »
Length:234
Mass (Da):25,862
Checksum:iB8DC7A16BCBC3F9F
GO
Isoform 4 (identifier: Q9H6Q3-4) [UniParc]FASTAAdd to basket
Also known as: p20

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.
     179-210: LADDICCLLKEPCVLQRAGPLPGKDIPLPVTV → GWPAPWQGYTPTCDCAEDTTQLERAGQLPPVF
     211-261: Missing.

Note: Produced by alternative initiation at Met-28 of isoform 2.Curated
Show »
Length:183
Mass (Da):20,380
Checksum:i6B4D8B535C3C31CC
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051361210V → M. Corresponds to variant dbSNP:rs34834764EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0187941 – 27Missing in isoform 3 and isoform 4. CuratedAdd BLAST27
Alternative sequenceiVSP_007240179 – 210LADDI…LPVTV → GWPAPWQGYTPTCDCAEDTT QLERAGQLPPVF in isoform 2 and isoform 4. CuratedAdd BLAST32
Alternative sequenceiVSP_007241211 – 261Missing in isoform 2 and isoform 4. CuratedAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF326353 mRNA Translation: AAL29204.1
AF290985 mRNA Translation: AAL38197.1
AF290986 mRNA Translation: AAL38198.1
AK025645 mRNA Translation: BAB15201.1
AK291513 mRNA Translation: BAF84202.1
AL031662 Genomic DNA No translation available.
AL050318 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76116.1
CH471077 Genomic DNA Translation: EAW76117.1
CH471077 Genomic DNA Translation: EAW76118.1
CH471077 Genomic DNA Translation: EAW76119.1
BC042041 mRNA Translation: AAH42041.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13282.1 [Q9H6Q3-1]
CCDS13283.1 [Q9H6Q3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_115590.1, NM_032214.3 [Q9H6Q3-1]
NP_778252.1, NM_175077.2 [Q9H6Q3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262866; ENSP00000262866; ENSG00000101082 [Q9H6Q3-1]
ENST00000360672; ENSP00000353890; ENSG00000101082 [Q9H6Q3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84174

UCSC genome browser

More...
UCSCi
uc002xfu.4, human [Q9H6Q3-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF326353 mRNA Translation: AAL29204.1
AF290985 mRNA Translation: AAL38197.1
AF290986 mRNA Translation: AAL38198.1
AK025645 mRNA Translation: BAB15201.1
AK291513 mRNA Translation: BAF84202.1
AL031662 Genomic DNA No translation available.
AL050318 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76116.1
CH471077 Genomic DNA Translation: EAW76117.1
CH471077 Genomic DNA Translation: EAW76118.1
CH471077 Genomic DNA Translation: EAW76119.1
BC042041 mRNA Translation: AAH42041.1
CCDSiCCDS13282.1 [Q9H6Q3-1]
CCDS13283.1 [Q9H6Q3-2]
RefSeqiNP_115590.1, NM_032214.3 [Q9H6Q3-1]
NP_778252.1, NM_175077.2 [Q9H6Q3-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4M4ZX-ray2.10A29-193[»]
SMRiQ9H6Q3
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi123928, 16 interactors
ELMiQ9H6Q3
IntActiQ9H6Q3, 8 interactors
MINTiQ9H6Q3
STRINGi9606.ENSP00000262866

PTM databases

iPTMnetiQ9H6Q3
PhosphoSitePlusiQ9H6Q3

Polymorphism and mutation databases

BioMutaiSLA2
DMDMi30173374

Proteomic databases

jPOSTiQ9H6Q3
MassIVEiQ9H6Q3
MaxQBiQ9H6Q3
PaxDbiQ9H6Q3
PeptideAtlasiQ9H6Q3
PRIDEiQ9H6Q3
ProteomicsDBi81005 [Q9H6Q3-1]
81006 [Q9H6Q3-2]
81007 [Q9H6Q3-3]
81008 [Q9H6Q3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26550, 418 antibodies

Genome annotation databases

EnsembliENST00000262866; ENSP00000262866; ENSG00000101082 [Q9H6Q3-1]
ENST00000360672; ENSP00000353890; ENSG00000101082 [Q9H6Q3-2]
GeneIDi84174
KEGGihsa:84174
UCSCiuc002xfu.4, human [Q9H6Q3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84174
DisGeNETi84174
EuPathDBiHostDB:ENSG00000101082.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLA2
HGNCiHGNC:17329, SLA2
HPAiENSG00000101082, Tissue enhanced (blood, lymphoid tissue)
MIMi606577, gene
neXtProtiNX_Q9H6Q3
OpenTargetsiENSG00000101082
PharmGKBiPA38231

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QPJN, Eukaryota
GeneTreeiENSGT00940000160331
HOGENOMiCLU_084503_1_0_1
InParanoidiQ9H6Q3
KOiK23698
OMAiKISHGWL
OrthoDBi1051480at2759
PhylomeDBiQ9H6Q3
TreeFamiTF354288

Enzyme and pathway databases

PathwayCommonsiQ9H6Q3
SignaLinkiQ9H6Q3
SIGNORiQ9H6Q3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84174, 6 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLA2, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLA2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84174
PharosiQ9H6Q3, Tbio

Protein Ontology

More...
PROi
PR:Q9H6Q3
RNActiQ9H6Q3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101082, Expressed in blood and 127 other tissues
GenevisibleiQ9H6Q3, HS

Family and domain databases

CDDicd10344, SH2_SLAP, 1 hit
Gene3Di3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR035054, SLAP2
IPR035052, SLAP_SH2
PANTHERiPTHR10155:SF6, PTHR10155:SF6, 1 hit
PfamiView protein in Pfam
PF00017, SH2, 1 hit
PF00018, SH3_1, 1 hit
PRINTSiPR00401, SH2DOMAIN
SMARTiView protein in SMART
SM00252, SH2, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF55550, SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50001, SH2, 1 hit
PS50002, SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSLAP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H6Q3
Secondary accession number(s): A8K648
, E1P5U1, E1P5U2, Q5TH27, Q5TH28, Q8WY18, Q96QI4, Q9H135
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: January 23, 2007
Last modified: October 7, 2020
This is version 169 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again