Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor expression-enhancing protein 4

Gene

REEP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • mitotic nuclear envelope reassembly Source: UniProtKB
  • nuclear envelope organization Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-381753 Olfactory Signaling Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor expression-enhancing protein 4
Gene namesi
Name:REEP4
Synonyms:C8orf20
ORF Names:PP432
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000168476.11
HGNCiHGNC:26176 REEP4
MIMi609349 gene
neXtProtiNX_Q9H6H4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei1 – 21HelicalSequence analysisAdd BLAST21
Transmembranei42 – 62HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000168476
PharmGKBiPA134890554

Polymorphism and mutation databases

BioMutaiREEP4
DMDMi74733607

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001018301 – 257Receptor expression-enhancing protein 4Add BLAST257

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei152PhosphoserineCombined sources1
Modified residuei194PhosphoserineCombined sources1
Modified residuei196PhosphothreonineCombined sources1
Modified residuei202PhosphoserineCombined sources1
Modified residuei250PhosphothreonineCombined sources1
Modified residuei253PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H6H4
MaxQBiQ9H6H4
PaxDbiQ9H6H4
PeptideAtlasiQ9H6H4
PRIDEiQ9H6H4
ProteomicsDBi80986
80987 [Q9H6H4-2]

PTM databases

iPTMnetiQ9H6H4
PhosphoSitePlusiQ9H6H4

Expressioni

Tissue specificityi

Expressed in circumvallate papillae and testis.1 Publication

Gene expression databases

BgeeiENSG00000168476
CleanExiHS_REEP4
ExpressionAtlasiQ9H6H4 baseline and differential
GenevisibleiQ9H6H4 HS

Organism-specific databases

HPAiHPA042683

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123253, 27 interactors
IntActiQ9H6H4, 102 interactors
MINTiQ9H6H4
STRINGi9606.ENSP00000303482

Structurei

3D structure databases

ProteinModelPortaliQ9H6H4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DP1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1726 Eukaryota
COG5052 LUCA
GeneTreeiENSGT00550000074535
HOGENOMiHOG000007472
HOVERGENiHBG056861
InParanoidiQ9H6H4
KOiK17338
OrthoDBiEOG091G0X58
PhylomeDBiQ9H6H4
TreeFamiTF314177

Family and domain databases

InterProiView protein in InterPro
IPR004345 TB2_DP1_HVA22
PANTHERiPTHR12300 PTHR12300, 1 hit
PfamiView protein in Pfam
PF03134 TB2_DP1_HVA22, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9H6H4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWMICRLV VLVFGMLCPA YASYKAVKTK NIREYVRWMM YWIVFALFMA
60 70 80 90 100
AEIVTDIFIS WFPFYYEIKM AFVLWLLSPY TKGASLLYRK FVHPSLSRHE
110 120 130 140 150
KEIDAYIVQA KERSYETVLS FGKRGLNIAA SAAVQAATKS QGALAGRLRS
160 170 180 190 200
FSMQDLRSIS DAPAPAYHDP LYLEDQVSHR RPPIGYRAGG LQDSDTEDEC
210 220 230 240 250
WSDTEAVPRA PARPREKPLI RSQSLRVVKR KPPVREGTSR SLKVRTRKKT

VPSDVDS
Length:257
Mass (Da):29,395
Last modified:March 1, 2001 - v1
Checksum:iEA7AB1B9EDB3DB1A
GO
Isoform 2 (identifier: Q9H6H4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-173: SQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYL → GTGPGACRTATPRMSVGQILRQSPGRQPGPERSP
     174-257: Missing.

Show »
Length:173
Mass (Da):19,692
Checksum:i390DCD281BF07CB6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149R → Q in AAG17256 (PubMed:15498874).Curated1
Sequence conflicti241S → P in BAB15274 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016636140 – 173SQGAL…DPLYL → GTGPGACRTATPRMSVGQIL RQSPGRQPGPERSP in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_016637174 – 257Missing in isoform 2. 1 PublicationAdd BLAST84

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562242 mRNA Translation: AAT70687.1
AK025899 mRNA Translation: BAB15274.1
AK025930 mRNA Translation: BAB15285.1
AK172846 mRNA Translation: BAD18810.1
AF218014 mRNA Translation: AAG17256.1
CR457353 mRNA Translation: CAG33634.1
AC105206 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63710.1
CH471080 Genomic DNA Translation: EAW63715.1
BC013048 mRNA Translation: AAH13048.1
BC050622 mRNA Translation: AAH50622.1
CCDSiCCDS6024.1 [Q9H6H4-1]
CCDS83257.1 [Q9H6H4-2]
RefSeqiNP_001303893.1, NM_001316964.1
NP_001303894.1, NM_001316965.1 [Q9H6H4-2]
NP_079508.2, NM_025232.3 [Q9H6H4-1]
UniGeneiHs.289063

Genome annotation databases

EnsembliENST00000306306; ENSP00000303482; ENSG00000168476 [Q9H6H4-1]
ENST00000334530; ENSP00000333889; ENSG00000168476 [Q9H6H4-2]
GeneIDi80346
KEGGihsa:80346
UCSCiuc003xau.2 human [Q9H6H4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiREEP4_HUMAN
AccessioniPrimary (citable) accession number: Q9H6H4
Secondary accession number(s): D3DSQ9
, Q86VL1, Q9H6I5, Q9HBP4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: March 1, 2001
Last modified: July 18, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health