Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (17 Jun 2020)
Sequence version 2 (10 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

ATP-dependent DNA helicase PIF1

Gene

PIF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-dependent ATPase and 5'-3' DNA helicase required for the maintenance of both mitochondrial and nuclear genome stability. Efficiently unwinds G-quadruplex (G4) DNA structures and forked RNA-DNA hybrids. Resolves G4 structures, preventing replication pausing and double-strand breaks (DSBs) at G4 motifs. Involved in the maintenance of telomeric DNA. Inhibits telomere elongation, de novo telomere formation and telomere addition to DSBs via catalytic inhibition of telomerase. Reduces the processivity of telomerase by displacing active telomerase from DNA ends. Releases telomerase by unwinding the short telomerase RNA/telomeric DNA hybrid that is the intermediate in the telomerase reaction. Possesses an intrinsic strand annealing activity.UniRule annotation7 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+UniRule annotation1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=0.17 mM for ATP1 Publication

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi228 – 235ATPUniRule annotation8
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi577 – 596UniRule annotationAdd BLAST20

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionDNA-binding, Helicase, Hydrolase
    Biological processDNA damage, DNA recombination, DNA repair
    LigandATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.6.4.12 2681

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    ATP-dependent DNA helicase PIF1UniRule annotation (EC:3.6.4.12UniRule annotation)
    Alternative name(s):
    DNA repair and recombination helicase PIF1UniRule annotation
    PIF1/RRM3 DNA helicase-like protein
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:PIF1UniRule annotation
    Synonyms:C15orf20
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000140451.12

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:26220 PIF1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    610953 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9H611

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Mitochondrion, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi234K → A: Loss of ATPase activity. Lower activity for single-stranded DNA. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    80119

    Open Targets

    More...
    OpenTargetsi
    ENSG00000140451

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA162399475

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q9H611 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    PIF1

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    152031656

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000899801 – 641ATP-dependent DNA helicase PIF1Add BLAST641

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27PhosphoserineCombined sources1
    Modified residuei151PhosphoserineCombined sources1

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9H611

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9H611

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q9H611

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9H611

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9H611

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9H611

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9H611

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    80948 [Q9H611-1]
    80949 [Q9H611-2]
    80950 [Q9H611-3]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9H611

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9H611

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Weak ubiquitous expression.

    <p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Tightly cell cycle regulated and expressed in late S/G2 phase.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000140451 Expressed in spleen and 100 other tissues

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9H611 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    ENSG00000140451 Tissue enhanced (lymphoid)

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer.

    Interacts with telomerase.

    UniRule annotation2 Publications

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...
    BioGRIDi
    123122, 14 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9H611, 2 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000328174

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    Q9H611 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1641
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9H611

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    Protein Data Bank in Europe - Knowledge Base

    More...
    PDBe-KBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 180PINTAdd BLAST180
    Regioni167 – 641Hydrolyzes ATP in the presence of both magnesium and single-stranded DNA; weak activity in the presence of RNA or double-stranded DNA; No unwinding activityAdd BLAST475

    <p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The PIF1 N-terminal (PINT) domain enhances the interaction with ssDNA through intrinsic binding activity, it also harbors DNA strand-annealing activity.

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the helicase family. PIF1 subfamily.UniRule annotation

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG0987 Eukaryota
    COG0507 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00530000063561

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_001613_7_1_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9H611

    KEGG Orthology (KO)

    More...
    KOi
    K15255

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    RACTSGK

    Database of Orthologous Groups

    More...
    OrthoDBi
    931726at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9H611

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF319207

    Family and domain databases

    HAMAP database of protein families

    More...
    HAMAPi
    MF_03176 PIF1, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR003840 DNA_helicase
    IPR010285 DNA_helicase_pif1-like
    IPR027417 P-loop_NTPase

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF02689 Herpes_Helicase, 1 hit
    PF05970 PIF1, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF52540 SSF52540, 2 hits

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket
    Isoform 1 (identifier: Q9H611-1) [UniParc]FASTAAdd to basket
    Also known as: Isoform alpha

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MLSGIEAAAG EYEDSELRCR VAVEELSPGG QPRRRQALRT AELSLGRNER
    60 70 80 90 100
    RELMLRLQAP GPAGRPRCFP LRAARLFTRF AEAGRSTLRL PAHDTPGAGA
    110 120 130 140 150
    VQLLLSDCPP DRLRRFLRTL RLKLAAAPGP GPASARAQLL GPRPRDFVTI
    160 170 180 190 200
    SPVQPEERRL RAATRVPDTT LVKRPVEPQA GAEPSTEAPR WPLPVKRLSL
    210 220 230 240 250
    PSTKPQLSEE QAAVLRAVLK GQSIFFTGSA GTGKSYLLKR ILGSLPPTGT
    260 270 280 290 300
    VATASTGVAA CHIGGTTLHA FAGIGSGQAP LAQCVALAQR PGVRQGWLNC
    310 320 330 340 350
    QRLVIDEISM VEADLFDKLE AVARAVRQQN KPFGGIQLII CGDFLQLPPV
    360 370 380 390 400
    TKGSQPPRFC FQSKSWKRCV PVTLELTKVW RQADQTFISL LQAVRLGRCS
    410 420 430 440 450
    DEVTRQLQAT ASHKVGRDGI VATRLCTHQD DVALTNERRL QELPGKVHRF
    460 470 480 490 500
    EAMDSNPELA STLDAQCPVS QLLQLKLGAQ VMLVKNLSVS RGLVNGARGV
    510 520 530 540 550
    VVGFEAEGRG LPQVRFLCGV TEVIHADRWT VQATGGQLLS RQQLPLQLAW
    560 570 580 590 600
    AMSIHKSQGM TLDCVEISLG RVFASGQAYV ALSRARSLQG LRVLDFDPMA
    610 620 630 640
    VRCDPRVLHF YATLRRGRSL SLESPDDDEA ASDQENMDPI L
    Length:641
    Mass (Da):69,799
    Last modified:July 10, 2007 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD755470008BA3CA8
    GO
    Isoform 2 (identifier: Q9H611-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-266: TGKSYLLKRILGSLPPTGTVATASTGVAACHIGGT → SGGREEVGGQWWGGIEEQGDLSNFAPVQEQGSHIC
         267-641: Missing.

    Show »
    Length:266
    Mass (Da):28,907
    Checksum:i0A291FB7E1339D56
    GO
    Isoform 3 (identifier: Q9H611-3) [UniParc]FASTAAdd to basket
    Also known as: Isoform beta

    The sequence of this isoform differs from the canonical sequence as follows:
         623-641: ESPDDDEAASDQENMDPIL → AAEGRGNEDR...FQGINSVWGH

    Show »
    Length:707
    Mass (Da):77,125
    Checksum:iDA015E47D50F8541
    GO
    Isoform 4 (identifier: Q9H611-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-53: Missing.

    Note: Produced by alternative initiation of isoform 1.Curated
    Show »
    Length:588
    Mass (Da):63,889
    Checksum:i706C693424557525
    GO

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033206640I → N. Corresponds to variant dbSNP:rs17802279Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0474571 – 53Missing in isoform 4. CuratedAdd BLAST53
    Alternative sequenceiVSP_026715232 – 266TGKSY…HIGGT → SGGREEVGGQWWGGIEEQGD LSNFAPVQEQGSHIC in isoform 2. 1 PublicationAdd BLAST35
    Alternative sequenceiVSP_026716267 – 641Missing in isoform 2. 1 PublicationAdd BLAST375
    Alternative sequenceiVSP_026717623 – 641ESPDD…MDPIL → AAEGRGNEDRCSGSSIRALG GDWWGLRLGAASKQRTELRC VSTARPSLAQPRTNTLQSLT KEHKLQNVHPYFKLLFQGIN SVWGH in isoform 3. 1 PublicationAdd BLAST19

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    DQ437529 mRNA Translation: ABD92708.1
    EU084033 mRNA Translation: ABW71293.1
    AY498716 mRNA Translation: AAS77398.1
    AB185926 mRNA Translation: BAE47454.1
    AB185927 mRNA Translation: BAE47455.1
    AK026345 mRNA Translation: BAB15456.1
    BC137503 mRNA Translation: AAI37504.1
    BC137504 mRNA Translation: AAI37505.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS10195.2 [Q9H611-1]
    CCDS66797.1 [Q9H611-3]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001273425.1, NM_001286496.1 [Q9H611-1]
    NP_001273426.1, NM_001286497.1 [Q9H611-3]
    NP_001273428.1, NM_001286499.1 [Q9H611-4]
    NP_079325.2, NM_025049.3 [Q9H611-1]
    XP_011520385.1, XM_011522083.2 [Q9H611-1]
    XP_011520386.1, XM_011522084.2 [Q9H611-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000268043; ENSP00000268043; ENSG00000140451 [Q9H611-1]
    ENST00000333425; ENSP00000328174; ENSG00000140451 [Q9H611-3]
    ENST00000559239; ENSP00000452792; ENSG00000140451 [Q9H611-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    80119

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:80119

    UCSC genome browser

    More...
    UCSCi
    uc002ant.4 human [Q9H611-1]

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    DQ437529 mRNA Translation: ABD92708.1
    EU084033 mRNA Translation: ABW71293.1
    AY498716 mRNA Translation: AAS77398.1
    AB185926 mRNA Translation: BAE47454.1
    AB185927 mRNA Translation: BAE47455.1
    AK026345 mRNA Translation: BAB15456.1
    BC137503 mRNA Translation: AAI37504.1
    BC137504 mRNA Translation: AAI37505.1
    CCDSiCCDS10195.2 [Q9H611-1]
    CCDS66797.1 [Q9H611-3]
    RefSeqiNP_001273425.1, NM_001286496.1 [Q9H611-1]
    NP_001273426.1, NM_001286497.1 [Q9H611-3]
    NP_001273428.1, NM_001286499.1 [Q9H611-4]
    NP_079325.2, NM_025049.3 [Q9H611-1]
    XP_011520385.1, XM_011522083.2 [Q9H611-1]
    XP_011520386.1, XM_011522084.2 [Q9H611-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    5FHHX-ray3.60A/B200-641[»]
    6HPHX-ray1.13A206-620[»]
    6HPQX-ray1.43A/B206-620[»]
    6HPTX-ray1.44A206-641[»]
    6HPUX-ray3.96A/B206-620[»]
    SMRiQ9H611
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi123122, 14 interactors
    IntActiQ9H611, 2 interactors
    STRINGi9606.ENSP00000328174

    PTM databases

    iPTMnetiQ9H611
    PhosphoSitePlusiQ9H611

    Polymorphism and mutation databases

    BioMutaiPIF1
    DMDMi152031656

    Proteomic databases

    EPDiQ9H611
    jPOSTiQ9H611
    MassIVEiQ9H611
    MaxQBiQ9H611
    PaxDbiQ9H611
    PeptideAtlasiQ9H611
    PRIDEiQ9H611
    ProteomicsDBi80948 [Q9H611-1]
    80949 [Q9H611-2]
    80950 [Q9H611-3]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More...
    Antibodypediai
    4360 109 antibodies

    Genome annotation databases

    EnsembliENST00000268043; ENSP00000268043; ENSG00000140451 [Q9H611-1]
    ENST00000333425; ENSP00000328174; ENSG00000140451 [Q9H611-3]
    ENST00000559239; ENSP00000452792; ENSG00000140451 [Q9H611-1]
    GeneIDi80119
    KEGGihsa:80119
    UCSCiuc002ant.4 human [Q9H611-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    80119
    DisGeNETi80119
    EuPathDBiHostDB:ENSG00000140451.12

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    PIF1
    HGNCiHGNC:26220 PIF1
    HPAiENSG00000140451 Tissue enhanced (lymphoid)
    MIMi610953 gene
    neXtProtiNX_Q9H611
    OpenTargetsiENSG00000140451
    PharmGKBiPA162399475

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG0987 Eukaryota
    COG0507 LUCA
    GeneTreeiENSGT00530000063561
    HOGENOMiCLU_001613_7_1_1
    InParanoidiQ9H611
    KOiK15255
    OMAiRACTSGK
    OrthoDBi931726at2759
    PhylomeDBiQ9H611
    TreeFamiTF319207

    Enzyme and pathway databases

    BRENDAi3.6.4.12 2681

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...
    BioGRID-ORCSi
    80119 1 hit in 787 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    PIF1 human

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    80119
    PharosiQ9H611 Tbio

    Protein Ontology

    More...
    PROi
    PR:Q9H611
    RNActiQ9H611 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000140451 Expressed in spleen and 100 other tissues
    GenevisibleiQ9H611 HS

    Family and domain databases

    HAMAPiMF_03176 PIF1, 1 hit
    InterProiView protein in InterPro
    IPR003840 DNA_helicase
    IPR010285 DNA_helicase_pif1-like
    IPR027417 P-loop_NTPase
    PfamiView protein in Pfam
    PF02689 Herpes_Helicase, 1 hit
    PF05970 PIF1, 1 hit
    SUPFAMiSSF52540 SSF52540, 2 hits

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPIF1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H611
    Secondary accession number(s): B2RPL7
    , Q1W5B6, Q330H5, Q33E24
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
    Last sequence update: July 10, 2007
    Last modified: June 17, 2020
    This is version 134 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again