CIAO2A

Functionⁱ

Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2, connecting cytosolic iron-sulfur protein maturation with cellular iron regulation (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).By similarity2 Publications

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	89	Zinc 1; shared with dimeric partner	1
Metal bindingⁱ	89	Zinc 2; shared with dimeric partner	1
Metal bindingⁱ	123	Zinc 1; shared with dimeric partner	1
Metal bindingⁱ	123	Zinc 2; shared with dimeric partner	1
Metal bindingⁱ	150	Zinc 1; shared with dimeric partner	1
Metal bindingⁱ	150	Zinc 2; shared with dimeric partner	1
Metal bindingⁱ	153	Zinc 1; shared with dimeric partner	1
Metal bindingⁱ	153	Zinc 2; shared with dimeric partner	1

GO - Molecular functionⁱ

metal ion binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

chromosome segregation Source: UniProtKB-KW
iron-sulfur cluster assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23891004
protein maturation by iron-sulfur cluster transfer
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23891004

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Chromosome partition
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cytosolic iron-sulfur assembly component 2ACurated Alternative name(s): MIP18 family protein FAM96A
Gene namesⁱ	Name:CIAO2AImported Synonyms:CIA2A1 Publication, FAM96AImported
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 15

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000166797.10
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:26235 CIAO2A
neXtProtⁱ	NX_Q9H5X1

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	84191
Open Targets More...OpenTargetsⁱ	ENSG00000166797
PharmGKBⁱ	PA142671829

Polymorphism and mutation databases

BioMutaⁱ	FAM96A
DMDMⁱ	20455359

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000212689	1 – 160	Cytosolic iron-sulfur assembly component 2AAdd BLAST		160

Proteomic databases

EPDⁱ	Q9H5X1
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9H5X1
PaxDbⁱ	Q9H5X1
PeptideAtlas More...PeptideAtlasⁱ	Q9H5X1
PRIDEⁱ	Q9H5X1
ProteomicsDBⁱ	80937 80938 [Q9H5X1-2]

PTM databases

iPTMnetⁱ	Q9H5X1
PhosphoSitePlusⁱ	Q9H5X1

Expressionⁱ

Tissue specificityⁱ

Substantially enriched in macrophages.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000166797 Expressed in 202 organ(s), highest expression level in liver
CleanExⁱ	HS_FAM96A
ExpressionAtlasⁱ	Q9H5X1 baseline and differential
Genevisibleⁱ	Q9H5X1 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA040459 HPA063729

HPAⁱ

HPA040459
HPA063729

Interactionⁱ

Subunit structureⁱ

Monomer and homodimer (PubMed:22683786). Component of the CIA complex (PubMed:23891004). Interacts with CIAO1 (PubMed:23891004, PubMed:22683786). Interacts with IREB2 (PubMed:23891004). Interacts with APAF1 (PubMed:25716227).3 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
CIAO1	O76071	10	EBI-752069,EBI-725145
TMED8	Q6PL24	4	EBI-752069,EBI-11603430

Protein-protein interaction databases

BioGridⁱ	123939, 12 interactors
IntActⁱ	Q9H5X1, 21 interactors
STRINGⁱ	9606.ENSP00000300030

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	31 – 44	Combined sources	14
Beta strandⁱ	50 – 55	Combined sources	6
Turnⁱ	56 – 60	Combined sources	5
Helixⁱ	64 – 66	Combined sources	3
Beta strandⁱ	67 – 73	Combined sources	7
Beta strandⁱ	76 – 81	Combined sources	6
Beta strandⁱ	86 – 88	Combined sources	3
Helixⁱ	92 – 107	Combined sources	16
Beta strandⁱ	112 – 120	Combined sources	9
Beta strandⁱ	122 – 124	Combined sources	3
Helixⁱ	129 – 134	Combined sources	6
Helixⁱ	136 – 144	Combined sources	9
Helixⁱ	146 – 156	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9H5X1
SMRⁱ	Q9H5X1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the MIP18 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG3381 Eukaryota COG5133 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000017697
HOGENOMⁱ	HOG000082425
HOVERGENⁱ	HBG029509
InParanoidⁱ	Q9H5X1
OMAⁱ	GLCLRIK
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0OZO
PhylomeDBⁱ	Q9H5X1
TreeFamⁱ	TF323934

Family and domain databases

Gene3Dⁱ	3.30.300.130, 1 hit
InterProⁱ	View protein in InterPro IPR034904 FSCA_dom_sf IPR039796 MIP18 IPR002744 MIP18-like
PANTHERⁱ	PTHR12377 PTHR12377, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01883 FeS_assembly_P, 1 hit
SUPFAMⁱ	SSF117916 SSF117916, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP 
        60         70         80         90        100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL 
       110        120        130        140        150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE 
       160
IVEQCVLEPD

Length:160

Mass (Da):18,355

Last modified:March 1, 2001 - v1

Checksum:ⁱ8580E4E397067319

GO

Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

« Hide

        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP 
        60         70         80         90        100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIVGNL 

HF

Note: No experimental confirmation available.

Show »

Length:102

Mass (Da):11,634

Checksum:ⁱ09416E6149875BE1

GO

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H0YKV4	H0YKV4_HUMAN	Cytosolic iron-sulfur assembly comp... Cytosolic iron-sulfur assembly component 2A (Family with sequence similarity 96, member A, isoform CRA_a)	CIAO2A FAM96A, hCG_33353	130	Annotation score:
H0YLH6	H0YLH6_HUMAN	Cytosolic iron-sulfur assembly comp... Cytosolic iron-sulfur assembly component 2A	CIAO2A	69	Annotation score:

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_042683	97 – 160	GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationAdd BLAST		64

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK026528 mRNA Translation: BAB15496.1 AK304202 mRNA Translation: BAH14131.1 AK312171 mRNA Translation: BAG35105.1 AC021541 Genomic DNA No translation available. CH471082 Genomic DNA Translation: EAW77661.1 CH471082 Genomic DNA Translation: EAW77662.1 BC008865 mRNA Translation: AAH08865.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10189.1 [Q9H5X1-1] CCDS45278.1 [Q9H5X1-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001014812.1, NM_001014812.2 [Q9H5X1-2] NP_001276037.1, NM_001289108.1 [Q9H5X1-2] NP_115607.1, NM_032231.5 [Q9H5X1-1]
UniGeneⁱ	Hs.439548

Genome annotation databases

Ensemblⁱ	ENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1] ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2] ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]
GeneIDⁱ	84191
KEGGⁱ	hsa:84191
UCSC genome browser More...UCSCⁱ	uc002amt.3 human [Q9H5X1-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9H5X1	MIP18 family protein FAM96A isoform a		MACMU		160	UniRef100_Q9H5X1
FAM96A isoform 1		PANTR		160
Uncharacterized protein		COLAP		160
Uncharacterized protein		CERAT		160
Uncharacterized protein		RHIRO		160
+5
Q9H5X1-2	FAM96A isoform 4		PANTR		102	UniRef100_A0A2J8NRN9
Uncharacterized protein		MACMU		102
Uncharacterized protein		COLAP		102
Uncharacterized protein		CERAT		102
Uncharacterized protein		RHIRO		102
+7

Protein	Similar proteins		Species	Score	Length	Source
Q9H5X1	Cytosolic iron-sulfur assembly component 2A		BOVIN		160	UniRef90_Q9H5X1
Cytosolic iron-sulfur assembly component 2A		MOUSE		160
MIP18 family protein FAM96A isoform a		MACMU		160
FAM96A isoform 1		PANTR		160
Uncharacterized protein		COLAP		160
+111
Q9H5X1-2	FAM96A isoform 4		PANTR		102	UniRef90_A0A2J8NRN9
Uncharacterized protein		MACMU		102
Uncharacterized protein		COLAP		102
Uncharacterized protein		CERAT		102
Uncharacterized protein		RHIRO		102
+29

Protein	Similar proteins		Species	Score	Length	Source
Q9H5X1	Cytosolic iron-sulfur assembly component 2A		BOVIN		160	UniRef50_Q9H5X1
Cytosolic iron-sulfur assembly component 2A		MOUSE		160
MIP18 family protein FAM96A isoform a		MACMU		160
FAM96A isoform 1		PANTR		160
Uncharacterized protein		COLAP		160
+236
Q9H5X1-2	FAM96A isoform 4		PANTR		102	UniRef50_A0A2J8NRN9
Uncharacterized protein		MACMU		102
Uncharacterized protein		COLAP		102
Uncharacterized protein		CERAT		102
Uncharacterized protein		RHIRO		102
+41

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK026528 mRNA Translation: BAB15496.1 AK304202 mRNA Translation: BAH14131.1 AK312171 mRNA Translation: BAG35105.1 AC021541 Genomic DNA No translation available. CH471082 Genomic DNA Translation: EAW77661.1 CH471082 Genomic DNA Translation: EAW77662.1 BC008865 mRNA Translation: AAH08865.1
CCDSⁱ	CCDS10189.1 [Q9H5X1-1] CCDS45278.1 [Q9H5X1-2]
RefSeqⁱ	NP_001014812.1, NM_001014812.2 [Q9H5X1-2] NP_001276037.1, NM_001289108.1 [Q9H5X1-2] NP_115607.1, NM_032231.5 [Q9H5X1-1]
UniGeneⁱ	Hs.439548

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2M5H	NMR	-	A	28-160	[»]
	3UX2	X-ray	1.80	A	31-157	[»]
	3UX3	X-ray	1.80	A/B	31-157	[»]
ProteinModelPortalⁱ	Q9H5X1
SMRⁱ	Q9H5X1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	123939, 12 interactors
IntActⁱ	Q9H5X1, 21 interactors
STRINGⁱ	9606.ENSP00000300030

PTM databases

iPTMnetⁱ	Q9H5X1
PhosphoSitePlusⁱ	Q9H5X1

Polymorphism and mutation databases

BioMutaⁱ	FAM96A
DMDMⁱ	20455359

Proteomic databases

EPDⁱ	Q9H5X1
MaxQBⁱ	Q9H5X1
PaxDbⁱ	Q9H5X1
PeptideAtlasⁱ	Q9H5X1
PRIDEⁱ	Q9H5X1
ProteomicsDBⁱ	80937 80938 [Q9H5X1-2]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1] ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2] ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]
GeneIDⁱ	84191
KEGGⁱ	hsa:84191
UCSCⁱ	uc002amt.3 human [Q9H5X1-1]

Organism-specific databases

CTDⁱ	84191
DisGeNETⁱ	84191
EuPathDBⁱ	HostDB:ENSG00000166797.10
GeneCardsⁱ	CIAO2A
H-InvDBⁱ	HIX0012334
HGNCⁱ	HGNC:26235 CIAO2A
HPAⁱ	HPA040459 HPA063729
neXtProtⁱ	NX_Q9H5X1
OpenTargetsⁱ	ENSG00000166797
PharmGKBⁱ	PA142671829
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3381 Eukaryota COG5133 LUCA
GeneTreeⁱ	ENSGT00390000017697
HOGENOMⁱ	HOG000082425
HOVERGENⁱ	HBG029509
InParanoidⁱ	Q9H5X1
OMAⁱ	GLCLRIK
OrthoDBⁱ	EOG091G0OZO
PhylomeDBⁱ	Q9H5X1
TreeFamⁱ	TF323934

Miscellaneous databases

ChiTaRSⁱ	FAM96A human
GenomeRNAiⁱ	84191
Protein Ontology More...PROⁱ	PR:Q9H5X1

Gene expression databases

Bgeeⁱ	ENSG00000166797 Expressed in 202 organ(s), highest expression level in liver
CleanExⁱ	HS_FAM96A
ExpressionAtlasⁱ	Q9H5X1 baseline and differential
Genevisibleⁱ	Q9H5X1 HS

Family and domain databases

Gene3Dⁱ	3.30.300.130, 1 hit
InterProⁱ	View protein in InterPro IPR034904 FSCA_dom_sf IPR039796 MIP18 IPR002744 MIP18-like
PANTHERⁱ	PTHR12377 PTHR12377, 1 hit
Pfamⁱ	View protein in Pfam PF01883 FeS_assembly_P, 1 hit
SUPFAMⁱ	SSF117916 SSF117916, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CIA2A_HUMAN
Accessionⁱ	Q9H5X1Primary (citable) accession number: Q9H5X1 Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 2, 2002
	Last sequence update:	March 1, 2001
	Last modified:	November 7, 2018
	This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 15
Human chromosome 15: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9H5X1 (CIA2A_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cytosolic iron-sulfur assembly component 2A

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ