Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic iron-sulfur assembly component 2A

Gene

CIAO2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2, connecting cytosolic iron-sulfur protein maturation with cellular iron regulation (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).By similarity2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi89Zinc 1; shared with dimeric partner1
Metal bindingi89Zinc 2; shared with dimeric partner1
Metal bindingi123Zinc 1; shared with dimeric partner1
Metal bindingi123Zinc 2; shared with dimeric partner1
Metal bindingi150Zinc 1; shared with dimeric partner1
Metal bindingi150Zinc 2; shared with dimeric partner1
Metal bindingi153Zinc 1; shared with dimeric partner1
Metal bindingi153Zinc 2; shared with dimeric partner1

GO - Molecular functioni

GO - Biological processi

  • chromosome segregation Source: UniProtKB-KW
  • iron-sulfur cluster assembly Source: UniProtKB
  • protein maturation by iron-sulfur cluster transfer Source: UniProtKB

Keywordsi

Biological processChromosome partition
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic iron-sulfur assembly component 2ACurated
Alternative name(s):
MIP18 family protein FAM96A
Gene namesi
Name:CIAO2AImported
Synonyms:CIA2A1 Publication, FAM96AImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000166797.10
HGNCiHGNC:26235 CIAO2A
neXtProtiNX_Q9H5X1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi84191
OpenTargetsiENSG00000166797
PharmGKBiPA142671829

Polymorphism and mutation databases

BioMutaiFAM96A
DMDMi20455359

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002126891 – 160Cytosolic iron-sulfur assembly component 2AAdd BLAST160

Proteomic databases

EPDiQ9H5X1
MaxQBiQ9H5X1
PaxDbiQ9H5X1
PeptideAtlasiQ9H5X1
PRIDEiQ9H5X1
ProteomicsDBi80937
80938 [Q9H5X1-2]

PTM databases

iPTMnetiQ9H5X1
PhosphoSitePlusiQ9H5X1

Expressioni

Tissue specificityi

Substantially enriched in macrophages.1 Publication

Gene expression databases

BgeeiENSG00000166797 Expressed in 202 organ(s), highest expression level in liver
CleanExiHS_FAM96A
ExpressionAtlasiQ9H5X1 baseline and differential
GenevisibleiQ9H5X1 HS

Organism-specific databases

HPAiHPA040459
HPA063729

Interactioni

Subunit structurei

Monomer and homodimer (PubMed:22683786). Component of the CIA complex (PubMed:23891004). Interacts with CIAO1 (PubMed:23891004, PubMed:22683786). Interacts with IREB2 (PubMed:23891004). Interacts with APAF1 (PubMed:25716227).3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi123939, 12 interactors
IntActiQ9H5X1, 21 interactors
STRINGi9606.ENSP00000300030

Structurei

Secondary structure

1160
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9H5X1
SMRiQ9H5X1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MIP18 family.Curated

Phylogenomic databases

eggNOGiKOG3381 Eukaryota
COG5133 LUCA
GeneTreeiENSGT00390000017697
HOGENOMiHOG000082425
HOVERGENiHBG029509
InParanoidiQ9H5X1
OMAiGLCLRIK
OrthoDBiEOG091G0OZO
PhylomeDBiQ9H5X1
TreeFamiTF323934

Family and domain databases

Gene3Di3.30.300.130, 1 hit
InterProiView protein in InterPro
IPR034904 FSCA_dom_sf
IPR039796 MIP18
IPR002744 MIP18-like
PANTHERiPTHR12377 PTHR12377, 1 hit
PfamiView protein in Pfam
PF01883 FeS_assembly_P, 1 hit
SUPFAMiSSF117916 SSF117916, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP
60 70 80 90 100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL
110 120 130 140 150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE
160
IVEQCVLEPD
Length:160
Mass (Da):18,355
Last modified:March 1, 2001 - v1
Checksum:i8580E4E397067319
GO
Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

Note: No experimental confirmation available.
Show »
Length:102
Mass (Da):11,634
Checksum:i09416E6149875BE1
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKV4H0YKV4_HUMAN
Cytosolic iron-sulfur assembly comp...
CIAO2A FAM96A, hCG_33353
130Annotation score:
H0YLH6H0YLH6_HUMAN
Cytosolic iron-sulfur assembly comp...
CIAO2A
69Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04268397 – 160GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA Translation: BAB15496.1
AK304202 mRNA Translation: BAH14131.1
AK312171 mRNA Translation: BAG35105.1
AC021541 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77661.1
CH471082 Genomic DNA Translation: EAW77662.1
BC008865 mRNA Translation: AAH08865.1
CCDSiCCDS10189.1 [Q9H5X1-1]
CCDS45278.1 [Q9H5X1-2]
RefSeqiNP_001014812.1, NM_001014812.2 [Q9H5X1-2]
NP_001276037.1, NM_001289108.1 [Q9H5X1-2]
NP_115607.1, NM_032231.5 [Q9H5X1-1]
UniGeneiHs.439548

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]
GeneIDi84191
KEGGihsa:84191
UCSCiuc002amt.3 human [Q9H5X1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA Translation: BAB15496.1
AK304202 mRNA Translation: BAH14131.1
AK312171 mRNA Translation: BAG35105.1
AC021541 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77661.1
CH471082 Genomic DNA Translation: EAW77662.1
BC008865 mRNA Translation: AAH08865.1
CCDSiCCDS10189.1 [Q9H5X1-1]
CCDS45278.1 [Q9H5X1-2]
RefSeqiNP_001014812.1, NM_001014812.2 [Q9H5X1-2]
NP_001276037.1, NM_001289108.1 [Q9H5X1-2]
NP_115607.1, NM_032231.5 [Q9H5X1-1]
UniGeneiHs.439548

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
ProteinModelPortaliQ9H5X1
SMRiQ9H5X1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123939, 12 interactors
IntActiQ9H5X1, 21 interactors
STRINGi9606.ENSP00000300030

PTM databases

iPTMnetiQ9H5X1
PhosphoSitePlusiQ9H5X1

Polymorphism and mutation databases

BioMutaiFAM96A
DMDMi20455359

Proteomic databases

EPDiQ9H5X1
MaxQBiQ9H5X1
PaxDbiQ9H5X1
PeptideAtlasiQ9H5X1
PRIDEiQ9H5X1
ProteomicsDBi80937
80938 [Q9H5X1-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]
GeneIDi84191
KEGGihsa:84191
UCSCiuc002amt.3 human [Q9H5X1-1]

Organism-specific databases

CTDi84191
DisGeNETi84191
EuPathDBiHostDB:ENSG00000166797.10
GeneCardsiCIAO2A
H-InvDBiHIX0012334
HGNCiHGNC:26235 CIAO2A
HPAiHPA040459
HPA063729
neXtProtiNX_Q9H5X1
OpenTargetsiENSG00000166797
PharmGKBiPA142671829
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3381 Eukaryota
COG5133 LUCA
GeneTreeiENSGT00390000017697
HOGENOMiHOG000082425
HOVERGENiHBG029509
InParanoidiQ9H5X1
OMAiGLCLRIK
OrthoDBiEOG091G0OZO
PhylomeDBiQ9H5X1
TreeFamiTF323934

Miscellaneous databases

ChiTaRSiFAM96A human
GenomeRNAii84191
PROiPR:Q9H5X1

Gene expression databases

BgeeiENSG00000166797 Expressed in 202 organ(s), highest expression level in liver
CleanExiHS_FAM96A
ExpressionAtlasiQ9H5X1 baseline and differential
GenevisibleiQ9H5X1 HS

Family and domain databases

Gene3Di3.30.300.130, 1 hit
InterProiView protein in InterPro
IPR034904 FSCA_dom_sf
IPR039796 MIP18
IPR002744 MIP18-like
PANTHERiPTHR12377 PTHR12377, 1 hit
PfamiView protein in Pfam
PF01883 FeS_assembly_P, 1 hit
SUPFAMiSSF117916 SSF117916, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCIA2A_HUMAN
AccessioniPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again