Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9H5X1 (CIA2A_HUMAN)

Entry version 147 (07 Oct 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cytosolic iron-sulfur assembly component 2A

Gene

CIAO2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2, connecting cytosolic iron-sulfur protein maturation with cellular iron regulation (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).By similarity2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi89Zinc 1; shared with dimeric partner1
Metal bindingi89Zinc 2; shared with dimeric partner1
Metal bindingi123Zinc 1; shared with dimeric partner1
Metal bindingi123Zinc 2; shared with dimeric partner1
Metal bindingi150Zinc 1; shared with dimeric partner1
Metal bindingi150Zinc 2; shared with dimeric partner1
Metal bindingi153Zinc 1; shared with dimeric partner1
Metal bindingi153Zinc 2; shared with dimeric partner1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processChromosome partition
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9H5X1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic iron-sulfur assembly component 2ACurated
Alternative name(s):
MIP18 family protein FAM96A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CIAO2AImported
Synonyms:CIA2A1 Publication, FAM96AImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000166797.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:26235, CIAO2A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		618382, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9H5X1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84191

Open Targets

More...OpenTargetsi		ENSG00000166797

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671829

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9H5X1, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295943

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FAM96A

Domain mapping of disease mutations (DMDM)

More...DMDMi		20455359

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002126891 – 160Cytosolic iron-sulfur assembly component 2AAdd BLAST160

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9H5X1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9H5X1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9H5X1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9H5X1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9H5X1

PeptideAtlas

More...PeptideAtlasi		Q9H5X1

PRoteomics IDEntifications database

More...PRIDEi		Q9H5X1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		80937 [Q9H5X1-1]
80938 [Q9H5X1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9H5X1

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q9H5X1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9H5X1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Substantially enriched in macrophages.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000166797, Expressed in liver and 214 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9H5X1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9H5X1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000166797, Tissue enhanced (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer and homodimer (PubMed:22683786).

Component of the CIA complex (PubMed:23891004).

Interacts with CIAO1 (PubMed:23891004, PubMed:22683786).

Interacts with IREB2 (PubMed:23891004).

Interacts with APAF1 (PubMed:25716227).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1160
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9H5X1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9H5X1

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MIP18 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3381, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000017697

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_075876_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9H5X1

Identification of Orthologs from Complete Genome Data

More...OMAi		HCSMANI

Database of Orthologous Groups

More...OrthoDBi		1408004at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9H5X1

TreeFam database of animal gene trees

More...TreeFami		TF323934

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.300.130, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR034904, FSCA_dom_sf
IPR039796, MIP18
IPR002744, MIP18-like

The PANTHER Classification System

More...PANTHERi		PTHR12377, PTHR12377, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01883, FeS_assembly_P, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF117916, SSF117916, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H5X1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQRVSGLLSW TLSRVLWLSG LSEPGAARQP RIMEEKALEV YDLIRTIRDP 
        60         70         80         90        100
EKPNTLEELE VVSESCVEVQ EINEEEYLVI IRFTPTVPHC SLATLIGLCL 
       110        120        130        140        150
RVKLQRCLPF KHKLEIYISE GTHSTEEDIN KQINDKERVA AAMENPNLRE 
       160
IVEQCVLEPD
Length:160
Mass (Da):18,355
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8580E4E397067319
GO
Isoform 2 (identifier: Q9H5X1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-160: GLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD → VGNLHF

Show »
Length:102
Mass (Da):11,634
Checksum:i09416E6149875BE1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YKV4H0YKV4_HUMAN
Cytosolic iron-sulfur assembly comp...
CIAO2A FAM96A, hCG_33353
130Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLH6H0YLH6_HUMAN
Cytosolic iron-sulfur assembly comp...
CIAO2A
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04268397 – 160GLCLR…VLEPD → VGNLHF in isoform 2. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK026528 mRNA Translation: BAB15496.1
AK304202 mRNA Translation: BAH14131.1
AK312171 mRNA Translation: BAG35105.1
AC021541 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77661.1
CH471082 Genomic DNA Translation: EAW77662.1
BC008865 mRNA Translation: AAH08865.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10189.1 [Q9H5X1-1]
CCDS45278.1 [Q9H5X1-2]

NCBI Reference Sequences

More...RefSeqi		NP_001014812.1, NM_001014812.2 [Q9H5X1-2]
NP_001276037.1, NM_001289108.1 [Q9H5X1-2]
NP_115607.1, NM_032231.5 [Q9H5X1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84191

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84191

UCSC genome browser

More...UCSCi		uc002amt.3, human [Q9H5X1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026528 mRNA Translation: BAB15496.1
AK304202 mRNA Translation: BAH14131.1
AK312171 mRNA Translation: BAG35105.1
AC021541 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77661.1
CH471082 Genomic DNA Translation: EAW77662.1
BC008865 mRNA Translation: AAH08865.1
CCDSiCCDS10189.1 [Q9H5X1-1]
CCDS45278.1 [Q9H5X1-2]
RefSeqiNP_001014812.1, NM_001014812.2 [Q9H5X1-2]
NP_001276037.1, NM_001289108.1 [Q9H5X1-2]
NP_115607.1, NM_032231.5 [Q9H5X1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2M5HNMR-A28-160[»]
3UX2X-ray1.80A31-157[»]
3UX3X-ray1.80A/B31-157[»]
BMRBiQ9H5X1
SMRiQ9H5X1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi123939, 36 interactors
IntActiQ9H5X1, 24 interactors
STRINGi9606.ENSP00000300030

Chemistry databases

ChEMBLiCHEMBL4295943

PTM databases

iPTMnetiQ9H5X1
MetOSiteiQ9H5X1
PhosphoSitePlusiQ9H5X1

Polymorphism and mutation databases

BioMutaiFAM96A
DMDMi20455359

Proteomic databases

EPDiQ9H5X1
jPOSTiQ9H5X1
MassIVEiQ9H5X1
MaxQBiQ9H5X1
PaxDbiQ9H5X1
PeptideAtlasiQ9H5X1
PRIDEiQ9H5X1
ProteomicsDBi80937 [Q9H5X1-1]
80938 [Q9H5X1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25761, 105 antibodies

Genome annotation databases

EnsembliENST00000300030; ENSP00000300030; ENSG00000166797 [Q9H5X1-1]
ENST00000380290; ENSP00000369644; ENSG00000166797 [Q9H5X1-2]
ENST00000557835; ENSP00000454079; ENSG00000166797 [Q9H5X1-2]
GeneIDi84191
KEGGihsa:84191
UCSCiuc002amt.3, human [Q9H5X1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84191
DisGeNETi84191
EuPathDBiHostDB:ENSG00000166797.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		CIAO2A
HGNCiHGNC:26235, CIAO2A
HPAiENSG00000166797, Tissue enhanced (liver)
MIMi618382, gene
neXtProtiNX_Q9H5X1
OpenTargetsiENSG00000166797
PharmGKBiPA142671829

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3381, Eukaryota
GeneTreeiENSGT00390000017697
HOGENOMiCLU_075876_4_0_1
InParanoidiQ9H5X1
OMAiHCSMANI
OrthoDBi1408004at2759
PhylomeDBiQ9H5X1
TreeFamiTF323934

Enzyme and pathway databases

PathwayCommonsiQ9H5X1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84191, 100 hits in 873 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FAM96A, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84191
PharosiQ9H5X1, Tbio

Protein Ontology

More...PROi		PR:Q9H5X1
RNActiQ9H5X1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000166797, Expressed in liver and 214 other tissues
ExpressionAtlasiQ9H5X1, baseline and differential
GenevisibleiQ9H5X1, HS

Family and domain databases

Gene3Di3.30.300.130, 1 hit
InterProiView protein in InterPro
IPR034904, FSCA_dom_sf
IPR039796, MIP18
IPR002744, MIP18-like
PANTHERiPTHR12377, PTHR12377, 1 hit
PfamiView protein in Pfam
PF01883, FeS_assembly_P, 1 hit
SUPFAMiSSF117916, SSF117916, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCIA2A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H5X1
Secondary accession number(s): A6NKS1, B2R5F8, B7Z8Z5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2002
Last sequence update: March 1, 2001
Last modified: October 7, 2020
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again