Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 196 (05 Jun 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Serine/threonine-protein kinase WNK1

Gene

WNK1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (By similarity).By similarity2 Publications
Isoform 3: Dominant-negative regulator of the longer isoform 1. Does not have kinase activity, does not directly inhibit WNK4 and has no direct effect on sodium and chloride ion transport. Downregulates sodium-chloride cotransporter activity indirectly by inhibiting isoform 1, it associates with isoform 1 and attenuates its kinase activity. In kidney, may play an important role regulating sodium and potassium balance.By similarity

Caution

Was named WNK/'with no lysine(K)' because key residues for catalysis, including the lysine involved in ATP binding, are either not conserved or differ compared to the residues described in other kinase family proteins.1 Publication
HSN2 was originally thought to be an intronless gene lying within a WNK1 gene intron. It has been shown to be a nervous system-specific exon of WNK1 included in isoform 4 and isoform 5 (PubMed:18521183).1 Publication
It is uncertain whether Met-1 or Met-214 is the initiator in isoform 4 and isoform 5.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

By hypertonicity. Activation requires autophosphorylation of Ser-382, that may be regulated by calcium. Phosphorylation of Ser-378 also promotes increased activity.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei231ATP; via amide nitrogenCombined sources1 Publication1
Binding sitei351ATPCombined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei368Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi301 – 304ATPCombined sources1 Publication4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Protein kinase inhibitor, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9H4A3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9H4A3

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q9H4A3 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK1Curated (EC:2.7.11.11 Publication)
Alternative name(s):
Erythrocyte 65 kDa protein
Short name:
p65
Kinase deficient protein
Protein kinase lysine-deficient 1Imported
Protein kinase with no lysine 11 Publication
Short name:
hWNK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WNK1Imported
Synonyms:HSN21 Publication, KDP, KIAA0344Imported, PRKWNK1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14540 WNK1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605232 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H4A3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pseudohypoaldosteronism 2C (PHA2C)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disorder characterized by severe hypertension, hyperkalemia, hyperchloremia, mild hyperchloremic metabolic acidosis in some cases, and correction of physiologic abnormalities by thiazide diuretics.
Related information in OMIM
Neuropathy, hereditary sensory and autonomic, 2A (HSAN2A)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN2A is an autosomal recessive disorder characterized by impairment of pain, temperature and touch sensation, onset of symptoms in infancy or early childhood, occurrence of distal extremity pathologies (paronychia, whitlows, ulcers, and Charcot joints), frequent amputations, sensory loss that affects all modalities of sensation (lower and upper limbs and perhaps the trunk as well), absence or diminution of tendon reflexes (usually in all limbs), minimal autonomic dysfunction, absence of sensory nerve action potentials, and virtual absence of myelinated fibers with decreased numbers of unmyelinated fibers in sural nerves.
Related information in OMIM

Keywords - Diseasei

Neurodegeneration, Neuropathy

Organism-specific databases

DisGeNET

More...
DisGeNETi
65125

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
WNK1

MalaCards human disease database

More...
MalaCardsi
WNK1
MIMi201300 phenotype
614492 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000060237

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
970 Hereditary sensory and autonomic neuropathy type 2
88940 Pseudohypoaldosteronism type 2C

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134944932
PA33782

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1075173

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2280

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WNK1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296453029

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000868191 – 2382Serine/threonine-protein kinase WNK1Add BLAST2382

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei19PhosphoserineCombined sources1
Modified residuei167PhosphoserineCombined sources1
Modified residuei174PhosphoserineCombined sources1
Modified residuei378Phosphoserine; by autocatalysisBy similarity1
Modified residuei382Phosphoserine; by autocatalysisBy similarity1
Modified residuei1261PhosphoserineCombined sources1
Modified residuei1978PhosphoserineCombined sources1
Modified residuei2002PhosphoserineCombined sources1
Modified residuei2011PhosphoserineCombined sources1
Modified residuei2012PhosphoserineCombined sources1
Modified residuei2027PhosphoserineCombined sources1
Modified residuei2029PhosphoserineCombined sources1
Modified residuei2032PhosphoserineCombined sources1
Modified residuei2121PhosphoserineCombined sources1
Modified residuei2270PhosphoserineBy similarity1
Modified residuei2286PhosphoserineBy similarity1
Modified residuei2370PhosphoserineCombined sources1
Modified residuei2372PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylation at Ser-382 is inhibited by intracellular calcium.By similarity
May be O-glycosylated.1 Publication
Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.2 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H4A3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H4A3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H4A3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H4A3

PeptideAtlas

More...
PeptideAtlasi
Q9H4A3

PRoteomics IDEntifications database

More...
PRIDEi
Q9H4A3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
80804
80805 [Q9H4A3-2]
80806 [Q9H4A3-4]
80807 [Q9H4A3-5]
80808 [Q9H4A3-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H4A3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H4A3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific and specifically expressed in the distal convoluted tubule (DCT) and connecting tubule (CNT) of the nephron.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000060237 Expressed in 240 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H4A3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H4A3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046541
HPA059157

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SYT2 (By similarity). Interacts with WNK3 and WNK4 (By similarity). Interacts with KLHL3 (PubMed:23387299, PubMed:23576762). Isoform 3: Interacts with isoform 1 (By similarity).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122403, 75 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H4A3

Database of interacting proteins

More...
DIPi
DIP-32648N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9H4A3

Protein interaction database and analysis system

More...
IntActi
Q9H4A3, 67 interactors

Molecular INTeraction database

More...
MINTi
Q9H4A3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341292

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9H4A3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12382
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H4A3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini221 – 479Protein kinasePROSITE-ProRule annotationAdd BLAST259

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni488 – 555Autoinhibitory domainBy similarityAdd BLAST68

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0584 Eukaryota
ENOG410XQWZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155474

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H4A3

KEGG Orthology (KO)

More...
KOi
K08867

Identification of Orthologs from Complete Genome Data

More...
OMAi
DADTQPK

Database of Orthologous Groups

More...
OrthoDBi
27514at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H4A3

TreeFam database of animal gene trees

More...
TreeFami
TF315363

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: WNK1 is a complex 33-exons gene, in total 9 WNK1 exons are alternatively spliced, some expressed in a tissue-specific manner. Additional isoforms seems to exist.

This entry has 6 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9H4A3-1) [UniParc]FASTAAdd to basket
Also known as: L-WNK1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGGAAEKQS STPGSLFLSP PAPAPKNGSS SDSSVGEKLG AAAADAVTGR
60 70 80 90 100
TEEYRRRRHT MDKDSRGAAA TTTTTEHRFF RRSVICDSNA TALELPGLPL
110 120 130 140 150
SLPQPSIPAA VPQSAPPEPH REETVTATAT SQVAQQPPAA AAPGEQAVAG
160 170 180 190 200
PAPSTVPSST SKDRPVSQPS LVGSKEEPPP ARSGSGGGSA KEPQEERSQQ
210 220 230 240 250
QDDIEELETK AVGMSNDGRF LKFDIEIGRG SFKTVYKGLD TETTVEVAWC
260 270 280 290 300
ELQDRKLTKS ERQRFKEEAE MLKGLQHPNI VRFYDSWEST VKGKKCIVLV
310 320 330 340 350
TELMTSGTLK TYLKRFKVMK IKVLRSWCRQ ILKGLQFLHT RTPPIIHRDL
360 370 380 390 400
KCDNIFITGP TGSVKIGDLG LATLKRASFA KSVIGTPEFM APEMYEEKYD
410 420 430 440 450
ESVDVYAFGM CMLEMATSEY PYSECQNAAQ IYRRVTSGVK PASFDKVAIP
460 470 480 490 500
EVKEIIEGCI RQNKDERYSI KDLLNHAFFQ EETGVRVELA EEDDGEKIAI
510 520 530 540 550
KLWLRIEDIK KLKGKYKDNE AIEFSFDLER DVPEDVAQEM VESGYVCEGD
560 570 580 590 600
HKTMAKAIKD RVSLIKRKRE QRQLVREEQE KKKQEESSLK QQVEQSSASQ
610 620 630 640 650
TGIKQLPSAS TGIPTASTTS ASVSTQVEPE EPEADQHQQL QYQQPSISVL
660 670 680 690 700
SDGTVDSGQG SSVFTESRVS SQQTVSYGSQ HEQAHSTGTV PGHIPSTVQA
710 720 730 740 750
QSQPHGVYPP SSVAQGQSQG QPSSSSLTGV SSSQPIQHPQ QQQGIQQTAP
760 770 780 790 800
PQQTVQYSLS QTSTSSEATT AQPVSQPQAP QVLPQVSAGK QLPVSQPVPT
810 820 830 840 850
IQGEPQIPVA TQPSVVPVHS GAHFLPVGQP LPTPLLPQYP VSQIPISTPH
860 870 880 890 900
VSTAQTGFSS LPITMAAGIT QPLLTLASSA TTAAIPGVST VVPSQLPTLL
910 920 930 940 950
QPVTQLPSQV HPQLLQPAVQ SMGIPANLGQ AAEVPLSSGD VLYQGFPPRL
960 970 980 990 1000
PPQYPGDSNI APSSNVASVC IHSTVLSPPM PTEVLATPGY FPTVVQPYVE
1010 1020 1030 1040 1050
SNLLVPMGGV GGQVQVSQPG GSLAQAPTTS SQQAVLESTQ GVSQVAPAEP
1060 1070 1080 1090 1100
VAVAQTQATQ PTTLASSVDS AHSDVASGMS DGNENVPSSS GRHEGRTTKR
1110 1120 1130 1140 1150
HYRKSVRSRS RHEKTSRPKL RILNVSNKGD RVVECQLETH NRKMVTFKFD
1160 1170 1180 1190 1200
LDGDNPEEIA TIMVNNDFIL AIERESFVDQ VREIIEKADE MLSEDVSVEP
1210 1220 1230 1240 1250
EGDQGLESLQ GKDDYGFSGS QKLEGEFKQP IPASSMPQQI GIPTSSLTQV
1260 1270 1280 1290 1300
VHSAGRRFIV SPVPESRLRE SKVFPSEITD TVAASTAQSP GMNLSHSASS
1310 1320 1330 1340 1350
LSLQQAFSEL RRAQMTEGPN TAPPNFSHTG PTFPVVPPFL SSIAGVPTTA
1360 1370 1380 1390 1400
AATAPVPATS SPPNDISTSV IQSEVTVPTE EGIAGVATST GVVTSGGLPI
1410 1420 1430 1440 1450
PPVSESPVLS SVVSSITIPA VVSISTTSPS LQVPTSTSEI VVSSTALYPS
1460 1470 1480 1490 1500
VTVSATSASA GGSTATPGPK PPAVVSQQAA GSTTVGATLT SVSTTTSFPS
1510 1520 1530 1540 1550
TASQLCIQLS SSTSTPTLAE TVVVSAHSLD KTSHSSTTGL AFSLSAPSSS
1560 1570 1580 1590 1600
SSPGAGVSSY ISQPGGLHPL VIPSVIASTP ILPQAAGPTS TPLLPQVPSI
1610 1620 1630 1640 1650
PPLVQPVANV PAVQQTLIHS QPQPALLPNQ PHTHCPEVDS DTQPKAPGID
1660 1670 1680 1690 1700
DIKTLEEKLR SLFSEHSSSG AQHASVSLET SLVIESTVTP GIPTTAVAPS
1710 1720 1730 1740 1750
KLLTSTTSTC LPPTNLPLGT VALPVTPVVT PGQVSTPVST TTSGVKPGTA
1760 1770 1780 1790 1800
PSKPPLTKAP VLPVGTELPA GTLPSEQLPP FPGPSLTQSQ QPLEDLDAQL
1810 1820 1830 1840 1850
RRTLSPEMIT VTSAVGPVSM AAPTAITEAG TQPQKGVSQV KEGPVLATSS
1860 1870 1880 1890 1900
GAGVFKMGRF QVSVAADGAQ KEGKNKSEDA KSVHFESSTS ESSVLSSSSP
1910 1920 1930 1940 1950
ESTLVKPEPN GITIPGISSD VPESAHKTTA SEAKSDTGQP TKVGRFQVTT
1960 1970 1980 1990 2000
TANKVGRFSV SKTEDKITDT KKEGPVASPP FMDLEQAVLP AVIPKKEKPE
2010 2020 2030 2040 2050
LSEPSHLNGP SSDPEAAFLS RDVDDGSGSP HSPHQLSSKS LPSQNLSQSL
2060 2070 2080 2090 2100
SNSFNSSYMS SDNESDIEDE DLKLELRRLR DKHLKEIQDL QSRQKHEIES
2110 2120 2130 2140 2150
LYTKLGKVPP AVIIPPAAPL SGRRRRPTKS KGSKSSRSSS LGNKSPQLSG
2160 2170 2180 2190 2200
NLSGQSAASV LHPQQTLHPP GNIPESGQNQ LLQPLKPSPS SDNLYSAFTS
2210 2220 2230 2240 2250
DGAISVPSLS APGQGTSSTN TVGATVNSQA AQAQPPAMTS SRKGTFTDDL
2260 2270 2280 2290 2300
HKLVDNWARD AMNLSGRRGS KGHMNYEGPG MARKFSAPGQ LCISMTSNLG
2310 2320 2330 2340 2350
GSAPISAASA TSLGHFTKSM CPPQQYGFPA TPFGAQWSGT GGPAPQPLGQ
2360 2370 2380
FQPVGTASLQ NFNISNLQKS ISNPPGSNLR TT
Note: Strong expression in dorsal root ganglia and spinal cord.
Length:2,382
Mass (Da):250,794
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i426785F98A452A0A
GO
Isoform 21 Publication (identifier: Q9H4A3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     740-740: Missing.
     792-1037: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:2,135
Mass (Da):225,560
Checksum:i2961D903C013A22C
GO
Isoform 3 (identifier: Q9H4A3-4) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1, Kidney-Specific

The sequence of this isoform differs from the canonical sequence as follows:
     1-407: Missing.
     408-437: FGMCMLEMATSEYPYSECQNAAQIYRRVTS → MDIKKKDFCSVFVIINSHCCCCPQKDCINE

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.
Show »
Length:1,975
Mass (Da):206,646
Checksum:iB03B35C0321782D3
GO
Isoform 4 (identifier: Q9H4A3-5) [UniParc]FASTAAdd to basket
Also known as: Brain and spinal cord variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-1037: AQGQSQGQPS...TTSSQQAVLE → PRRGRSMSVC...VLPQVSAGKQ

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.
Show »
Length:2,634
Mass (Da):279,538
Checksum:i2F95DCDA28619B4C
GO
Isoform 5 (identifier: Q9H4A3-6) [UniParc]FASTAAdd to basket
Also known as: Dorsal root ganglia and sciatic nerve variant, DRG and sciatic nerve variant

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: V → VPQSMAHPCG...SSGGSALHPQ
     792-944: Missing.

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.
Show »
Length:2,642
Mass (Da):279,713
Checksum:iD0AB5C95ABFF46A4
GO
Isoform 6 (identifier: Q9H4A3-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     713-713: V → VPQSMAHPCG...SSGGSALHPQ
     2215-2215: G → GCAKFNCASEQVTFKPGGRRTRFLRKMVKKVCPCNQLCR

Note: Contains the nervous system-specific exon HSN2. Produced by alternative splicing.
Show »
Length:2,833
Mass (Da):299,725
Checksum:i24CA46FC81669858
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GWT4F5GWT4_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
2,134Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J299A0A0B4J299_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
434Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UYG0F6UYG0_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFF1H0YFF1_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH68H0YH68_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YH79H0YH79_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF81H0YF81_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L251I3L251_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFP5H0YFP5_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFK5H0YFK5_HUMAN
Serine/threonine-protein kinase WNK...
WNK1
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF31483 differs from that shown. Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated
The sequence AAI30468 differs from that shown. Probable cloning artifact.Curated
The sequence AAI30470 differs from that shown. Probable cloning artifact.Curated
The sequence DAA04494 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti164R → S AA sequence (PubMed:2507249).Curated1
Sequence conflicti1836Missing in BAA20802 (PubMed:9205841).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_041309141A → T1 PublicationCorresponds to variant dbSNP:rs11554421EnsemblClinVar.1
Natural variantiVAR_041310149A → V1 PublicationCorresponds to variant dbSNP:rs34880640EnsemblClinVar.1
Natural variantiVAR_041311419E → Q in a breast pleomorphic lobular carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_041312509I → T1 PublicationCorresponds to variant dbSNP:rs34728563EnsemblClinVar.1
Natural variantiVAR_041313527D → G1 PublicationCorresponds to variant dbSNP:rs34408667Ensembl.1
Natural variantiVAR_019992665T → I1 PublicationCorresponds to variant dbSNP:rs2286007EnsemblClinVar.1
Natural variantiVAR_041314674T → A1 PublicationCorresponds to variant dbSNP:rs11833299EnsemblClinVar.1
Natural variantiVAR_041315823H → R1 PublicationCorresponds to variant dbSNP:rs56015776EnsemblClinVar.1
Natural variantiVAR_0590331056T → P3 PublicationsCorresponds to variant dbSNP:rs956868EnsemblClinVar.1
Natural variantiVAR_0356401199E → G in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0590341506C → S3 PublicationsCorresponds to variant dbSNP:rs7955371EnsemblClinVar.1
Natural variantiVAR_0413161546A → V1 PublicationCorresponds to variant dbSNP:rs56351358Ensembl.1
Natural variantiVAR_0356411799Q → E in breast cancer samples; infiltrating ductal carcinoma; somatic mutation. 2 Publications1
Natural variantiVAR_0413171808M → I3 PublicationsCorresponds to variant dbSNP:rs12828016EnsemblClinVar.1
Natural variantiVAR_0413181823P → L1 PublicationCorresponds to variant dbSNP:rs17755373EnsemblClinVar.1
Natural variantiVAR_0413191957R → H1 PublicationCorresponds to variant dbSNP:rs36083875Ensembl.1
Natural variantiVAR_0413202190S → C in a breast pleomorphic lobular carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_0413212362F → L in a lung adenocarcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_0413222380R → W1 PublicationCorresponds to variant dbSNP:rs56262445EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0506341 – 407Missing in isoform 3. CuratedAdd BLAST407
Alternative sequenceiVSP_050637408 – 437FGMCM…RRVTS → MDIKKKDFCSVFVIINSHCC CCPQKDCINE in isoform 3. CuratedAdd BLAST30
Alternative sequenceiVSP_040267713V → VPQSMAHPCGGTPTYPESQI FFPTIHERPVSFSPPPTCPP KVAISQRRKSTSFLEAQTHH FQPLLRTVGQSLLPPGGSPT NWTPEAVVMLGTTASRVTGE SCEIQVHPMFEPSQVYSDYR PGLVLPEEAHYFIPQEAVYV AGVHYQARVAEQYEGIPYNS SVLSSPMKQIPEQKPVQGGP TSSSVFEFPSGQAFLVGHLQ NLRLDSGLGPGSPLSSISAP ISTDATRLKFHPVFVPHSAP AVLTHNNESRSNCVFEFHVH TPSSSSGEGGGILPQRVYRN RQVAVDLNQEELPPQSVGLH GYLQPVTEEKHNYHAPELTV SVVEPIGQNWPIGSPEYSSD SSQITSSDPSDFQSPPPTGG AAAPFGSDVSMPFIHLPQTV LQESPLFFCFPQGTTSQQVL TASFSSGGSALHPQ in isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_040268714 – 1037AQGQS…QAVLE → PRRGRSMSVCVPIFLLLPLC PASLPVLFHPTASTVCTSFS FPPPDCPEETFAEKLSKALE SVLPMHSASQRKHRRSSLPS LFVSTPQSMAHPCGGTPTYP ESQIFFPTIHERPVSFSPPP TCPPKVAISQRRKSTSFLEA QTHHFQPLLRTVGQSLLPPG GSPTNWTPEAVVMLGTTASR VTGESCEIQVHPMFEPSQVY SDYRPGLVLPEEAHYFIPQE AVYVAGVHYQARVAEQYEGI PYNSSVLSSPMKQIPEQKPV QGGPTSSSVFEFPSGQAFLV GHLQNLRLDSGLGPGSPLSS ISAPISTDATRLKFHPVFVP HSAPAVLTHNNESRSNCVFE FHVHTPSSSSGEGGGILPQR VYRNRQVAVDLNQEELPPQS VGLHGYLQPVTEEKHNYHAP ELTVSVVEPIGQNWPIGSPE YSSDSSQITSSDPSDFQSPP PTGGAAAPFGSDVSMPFIHL PQTVLQESPLFFCFPQGTTS QQVLTASFSSGGSALHPQAQ GQSQGQPSSSSLTGVSSSQP IQHPQQQQGIQQTAPPQQTV QYSLSQTSTSSEATTAQPVS QPQAPQVLPQVSAGKQ in isoform 4. CuratedAdd BLAST324
Alternative sequenceiVSP_040269740Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_050638792 – 1037Missing in isoform 2. 1 PublicationAdd BLAST246
Alternative sequenceiVSP_040270792 – 944Missing in isoform 5. CuratedAdd BLAST153
Alternative sequenceiVSP_0537672215G → GCAKFNCASEQVTFKPGGRR TRFLRKMVKKVCPCNQLCR in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ296290 mRNA Translation: CAC15059.1
JQ358908 mRNA Translation: AEY99342.1
FJ515833 Genomic DNA Translation: ACS13726.1
FJ515833 Genomic DNA Translation: ACS13727.1
FJ515833 Genomic DNA Translation: ACS13728.1
AC004765 Genomic DNA No translation available.
AC004803 Genomic DNA No translation available.
AF061944 mRNA Translation: AAF31483.1 Sequence problems.
AB002342 mRNA Translation: BAA20802.2
AY231477 mRNA Translation: AAO46160.1
BC013629 mRNA Translation: AAH13629.2
BC130467 mRNA Translation: AAI30468.1 Sequence problems.
BC130469 mRNA Translation: AAI30470.1 Sequence problems.
BK004108 Genomic DNA Translation: DAA04494.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73419.1 [Q9H4A3-5]
CCDS8506.1 [Q9H4A3-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001171914.1, NM_001184985.1 [Q9H4A3-6]
NP_055638.2, NM_014823.2
NP_061852.3, NM_018979.3 [Q9H4A3-1]
NP_998820.3, NM_213655.4 [Q9H4A3-5]
XP_016875326.1, XM_017019837.1
XP_016875327.1, XM_017019838.1 [Q9H4A3-2]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65125

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65125

UCSC genome browser

More...
UCSCi
uc001qio.4 human [Q9H4A3-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ296290 mRNA Translation: CAC15059.1
JQ358908 mRNA Translation: AEY99342.1
FJ515833 Genomic DNA Translation: ACS13726.1
FJ515833 Genomic DNA Translation: ACS13727.1
FJ515833 Genomic DNA Translation: ACS13728.1
AC004765 Genomic DNA No translation available.
AC004803 Genomic DNA No translation available.
AF061944 mRNA Translation: AAF31483.1 Sequence problems.
AB002342 mRNA Translation: BAA20802.2
AY231477 mRNA Translation: AAO46160.1
BC013629 mRNA Translation: AAH13629.2
BC130467 mRNA Translation: AAI30468.1 Sequence problems.
BC130469 mRNA Translation: AAI30470.1 Sequence problems.
BK004108 Genomic DNA Translation: DAA04494.1 Sequence problems.
CCDSiCCDS73419.1 [Q9H4A3-5]
CCDS8506.1 [Q9H4A3-1]
RefSeqiNP_001171914.1, NM_001184985.1 [Q9H4A3-6]
NP_055638.2, NM_014823.2
NP_061852.3, NM_018979.3 [Q9H4A3-1]
NP_998820.3, NM_213655.4 [Q9H4A3-5]
XP_016875326.1, XM_017019837.1
XP_016875327.1, XM_017019838.1 [Q9H4A3-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4PWNX-ray1.84A210-482[»]
5TF9X-ray2.50A/B206-483[»]
5WDYX-ray2.46A/B206-483[»]
5WE8X-ray2.01A/B206-483[»]
6FBKX-ray1.74P1247-1269[»]
SMRiQ9H4A3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122403, 75 interactors
CORUMiQ9H4A3
DIPiDIP-32648N
ELMiQ9H4A3
IntActiQ9H4A3, 67 interactors
MINTiQ9H4A3
STRINGi9606.ENSP00000341292

Chemistry databases

BindingDBiQ9H4A3
ChEMBLiCHEMBL1075173
GuidetoPHARMACOLOGYi2280

Protein family/group databases

MoonDBiQ9H4A3 Predicted

PTM databases

iPTMnetiQ9H4A3
PhosphoSitePlusiQ9H4A3

Polymorphism and mutation databases

BioMutaiWNK1
DMDMi296453029

Proteomic databases

EPDiQ9H4A3
jPOSTiQ9H4A3
MaxQBiQ9H4A3
PaxDbiQ9H4A3
PeptideAtlasiQ9H4A3
PRIDEiQ9H4A3
ProteomicsDBi80804
80805 [Q9H4A3-2]
80806 [Q9H4A3-4]
80807 [Q9H4A3-5]
80808 [Q9H4A3-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65125
Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi65125
KEGGihsa:65125
UCSCiuc001qio.4 human [Q9H4A3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65125
DisGeNETi65125

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WNK1
GeneReviewsiWNK1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010312
HGNCiHGNC:14540 WNK1
HPAiHPA046541
HPA059157
MalaCardsiWNK1
MIMi201300 phenotype
605232 gene
614492 phenotype
neXtProtiNX_Q9H4A3
OpenTargetsiENSG00000060237
Orphaneti970 Hereditary sensory and autonomic neuropathy type 2
88940 Pseudohypoaldosteronism type 2C
PharmGKBiPA134944932
PA33782

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0584 Eukaryota
ENOG410XQWZ LUCA
GeneTreeiENSGT00940000155474
InParanoidiQ9H4A3
KOiK08867
OMAiDADTQPK
OrthoDBi27514at2759
PhylomeDBiQ9H4A3
TreeFamiTF315363

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels
SignaLinkiQ9H4A3
SIGNORiQ9H4A3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WNK1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
WNK1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65125

Protein Ontology

More...
PROi
PR:Q9H4A3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000060237 Expressed in 240 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ9H4A3 baseline and differential
GenevisibleiQ9H4A3 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWNK1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H4A3
Secondary accession number(s): A1L4B0
, C5HTZ5, C5HTZ6, C5HTZ7, H6WZW3, O15052, P54963, Q4VBX9, Q6IFS5, Q86WL5, Q8N673, Q96CZ6, Q9P1S9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 18, 2010
Last modified: June 5, 2019
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again