Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (26 Feb 2020)
Sequence version 2 (14 Oct 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ammonium transporter Rh type B

Gene

RHBG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a specific ammonium transporter.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAmmonia transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-444411 Rhesus glycoproteins mediate ammonium transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.11.4.2 the ammonium transporter channel (amt) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ammonium transporter Rh type B
Alternative name(s):
Rhesus blood group family type B glycoprotein
Short name:
Rh family type B glycoprotein
Short name:
Rh type B glycoprotein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RHBG
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14572 RHBG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607079 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H310

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 13CytoplasmicSequence analysisAdd BLAST13
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei14 – 34HelicalSequence analysisAdd BLAST21
Topological domaini35 – 61ExtracellularSequence analysisAdd BLAST27
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Topological domaini83 – 86CytoplasmicSequence analysis4
Transmembranei87 – 107HelicalSequence analysisAdd BLAST21
Topological domaini108 – 124ExtracellularSequence analysisAdd BLAST17
Transmembranei125 – 145HelicalSequence analysisAdd BLAST21
Topological domaini146 – 149CytoplasmicSequence analysis4
Transmembranei150 – 170HelicalSequence analysisAdd BLAST21
Topological domaini171 – 178ExtracellularSequence analysis8
Transmembranei179 – 201HelicalSequence analysisAdd BLAST23
Topological domaini202 – 219CytoplasmicSequence analysisAdd BLAST18
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Topological domaini241 – 251ExtracellularSequence analysisAdd BLAST11
Transmembranei252 – 272HelicalSequence analysisAdd BLAST21
Topological domaini273 – 282CytoplasmicSequence analysis10
Transmembranei283 – 303HelicalSequence analysisAdd BLAST21
Topological domaini304ExtracellularSequence analysis1
Transmembranei305 – 325HelicalSequence analysisAdd BLAST21
Topological domaini326 – 346CytoplasmicSequence analysisAdd BLAST21
Transmembranei347 – 367HelicalSequence analysisAdd BLAST21
Topological domaini368 – 393ExtracellularSequence analysisAdd BLAST26
Transmembranei394 – 414HelicalSequence analysisAdd BLAST21
Topological domaini415 – 441CytoplasmicSequence analysisAdd BLAST27

Keywords - Cellular componenti

Cell membrane, Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi419F → A: Loss of interaction with ANK3. Intracellular retention; when associated with A-420 and A-421. 1 Publication1
Mutagenesisi420L → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-421. 1 Publication1
Mutagenesisi421D → A: Partial loss of interaction with ANK3. Intracellular retention; when associated with A-419 and A-420. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
57127

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34385

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H310 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RHBG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
209572666

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002835971 – 441Ammonium transporter Rh type BAdd BLAST441

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi49N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H310

PeptideAtlas

More...
PeptideAtlasi
Q9H310

PRoteomics IDEntifications database

More...
PRIDEi
Q9H310

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80643 [Q9H310-1]
80644 [Q9H310-2]
80645 [Q9H310-3]
80646 [Q9H310-4]
80647 [Q9H310-5]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H310

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in kidney. Also detected in liver and ovary.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Fetally expressed by kidney and to a lower extent in liver.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132677 Expressed in right hemisphere of cerebellum and 79 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H310 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H310 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042726
HPA048489

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with ANK2 and ANK3; required for targeting to the basolateral membrane.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121390, 1 interactor

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H310

Protein interaction database and analysis system

More...
IntActi
Q9H310, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000441197

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H310 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H310

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni416 – 424Interaction with ANK31 Publication9

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3796 Eukaryota
ENOG410XTF8 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021386_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H310

KEGG Orthology (KO)

More...
KOi
K06580

Database of Orthologous Groups

More...
OrthoDBi
910733at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H310

TreeFam database of animal gene trees

More...
TreeFami
TF314450

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.3430.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029020 Ammonium/urea_transptr
IPR024041 NH4_transpt_AmtB-like_dom
IPR002229 RhesusRHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00909 Ammonium_transp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00342 RHESUSRHD

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H310-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGSPSRAAG RRLQLPLLCL FLQGATAVLF AVFVRYNHKT DAALWHRSNH
60 70 80 90 100
SNADNEFYFR YPSFQDVHAM VFVGFGFLMV FLQRYGFSSV GFTFLLAAFA
110 120 130 140 150
LQWSTLVQGF LHSFHGGHIH VGVESMINAD FCAGAVLISF GAVLGKTGPT
160 170 180 190 200
QLLLMALLEV VLFGINEFVL LHLLGVRDAG GSMTIHTFGA YFGLVLSRVL
210 220 230 240 250
YRPQLEKSKH RQGSVYHSDL FAMIGTIFLW IFWPSFNAAL TALGAGQHRT
260 270 280 290 300
ALNTYYSLAA STLGTFALSA LVGEDGRLDM VHIQNAALAG GVVVGTSSEM
310 320 330 340 350
MLTPFGALAA GFLAGTVSTL GYKFFTPILE SKFKVQDTCG VHNLHGMPGV
360 370 380 390 400
LGALLGVLVA GLATHEAYGD GLESVFPLIA EGQRSATSQA MHQLFGLFVT
410 420 430 440
LMFASVGGGL GGLLLKLPFL DSPPRLPALR GPSSLAGAWR A
Length:441
Mass (Da):47,231
Last modified:October 14, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i21EE1FE592F2E1EE
GO
Isoform 2 (identifier: Q9H310-2) [UniParc]FASTAAdd to basket
Also known as: RhBG-2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: Missing.
     31-63: AVFVRYNHKTDAALWHRSNHSNADNEFYFRYPS → MNFTFATQKSLTLLPRLECNGAISAHCNLHLPG

Show »
Length:411
Mass (Da):43,675
Checksum:iB9C06223F4445B97
GO
Isoform 3 (identifier: Q9H310-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.
     175-175: G → GVRVWGGMESGVGGGQGQPLSQERGGGGGVLPLTPPPQ

Show »
Length:409
Mass (Da):42,978
Checksum:iD0FE23FCAC1344ED
GO
Isoform 4 (identifier: Q9H310-4) [UniParc]FASTAAdd to basket
Also known as: RhBG-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.

Show »
Length:372
Mass (Da):39,396
Checksum:i47C840C8A19763F5
GO
Isoform 5 (identifier: Q9H310-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: Missing.
     372-441: Missing.

Show »
Length:302
Mass (Da):32,092
Checksum:iB758ABDDBA1E2E90
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WUR4A0A087WUR4_HUMAN
Ammonium transporter Rh type B
RHBG
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Q468F6Q468_HUMAN
Ammonium transporter Rh type B
RHBG
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTF7A0A087WTF7_HUMAN
Ammonium transporter Rh type B
RHBG
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG01086 differs from that shown. Reason: Frameshift.Curated
The sequence AAL05978 differs from that shown. Reason: Frameshift.Curated
The sequence AAN34363 differs from that shown. Reason: Frameshift.Curated
The sequence AAN34364 differs from that shown. Reason: Frameshift.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03149776G → D2 PublicationsCorresponds to variant dbSNP:rs2245623Ensembl.1
Natural variantiVAR_031498143V → D1 PublicationCorresponds to variant dbSNP:rs11586833Ensembl.1
Natural variantiVAR_031499315G → R1 PublicationCorresponds to variant dbSNP:rs3748569Ensembl.1
Natural variantiVAR_053637339C → R. Corresponds to variant dbSNP:rs3748567Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0243401 – 69Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST69
Alternative sequenceiVSP_0243411 – 30Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_02434231 – 63AVFVR…FRYPS → MNFTFATQKSLTLLPRLECN GAISAHCNLHLPG in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_024343175G → GVRVWGGMESGVGGGQGQPL SQERGGGGGVLPLTPPPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_037136372 – 441Missing in isoform 5. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF193807 mRNA Translation: AAG01086.1 Frameshift.
AF219980 AF219979 Genomic DNA Translation: AAL05978.1 Frameshift.
AY139092 mRNA Translation: AAN34363.1 Frameshift.
AY139093 mRNA Translation: AAN34364.1 Frameshift.
AK054780 mRNA Translation: BAG51423.1
AK290840 mRNA Translation: BAF83529.1
AL139130 Genomic DNA No translation available.
AL589685 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52961.1
BC065218 mRNA Translation: AAH65218.1

NCBI Reference Sequences

More...
RefSeqi
NP_001243324.1, NM_001256395.1
NP_001243325.1, NM_001256396.1
NP_065140.3, NM_020407.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000537040; ENSP00000441197; ENSG00000132677

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57127

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57127

UCSC genome browser

More...
UCSCi
uc031vbi.2 human [Q9H310-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF193807 mRNA Translation: AAG01086.1 Frameshift.
AF219980 AF219979 Genomic DNA Translation: AAL05978.1 Frameshift.
AY139092 mRNA Translation: AAN34363.1 Frameshift.
AY139093 mRNA Translation: AAN34364.1 Frameshift.
AK054780 mRNA Translation: BAG51423.1
AK290840 mRNA Translation: BAF83529.1
AL139130 Genomic DNA No translation available.
AL589685 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52961.1
BC065218 mRNA Translation: AAH65218.1
RefSeqiNP_001243324.1, NM_001256395.1
NP_001243325.1, NM_001256396.1
NP_065140.3, NM_020407.4

3D structure databases

SMRiQ9H310
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121390, 1 interactor
CORUMiQ9H310
IntActiQ9H310, 2 interactors
STRINGi9606.ENSP00000441197

Protein family/group databases

TCDBi1.A.11.4.2 the ammonium transporter channel (amt) family

PTM databases

PhosphoSitePlusiQ9H310

Polymorphism and mutation databases

BioMutaiRHBG
DMDMi209572666

Proteomic databases

PaxDbiQ9H310
PeptideAtlasiQ9H310
PRIDEiQ9H310
ProteomicsDBi80643 [Q9H310-1]
80644 [Q9H310-2]
80645 [Q9H310-3]
80646 [Q9H310-4]
80647 [Q9H310-5]

Genome annotation databases

EnsembliENST00000537040; ENSP00000441197; ENSG00000132677
GeneIDi57127
KEGGihsa:57127
UCSCiuc031vbi.2 human [Q9H310-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57127
DisGeNETi57127

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RHBG
HGNCiHGNC:14572 RHBG
HPAiHPA042726
HPA048489
MIMi607079 gene
neXtProtiNX_Q9H310
PharmGKBiPA34385

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3796 Eukaryota
ENOG410XTF8 LUCA
HOGENOMiCLU_021386_0_0_1
InParanoidiQ9H310
KOiK06580
OrthoDBi910733at2759
PhylomeDBiQ9H310
TreeFamiTF314450

Enzyme and pathway databases

ReactomeiR-HSA-444411 Rhesus glycoproteins mediate ammonium transport

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RHBG human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RHBG

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57127
PharosiQ9H310 Tbio

Protein Ontology

More...
PROi
PR:Q9H310
RNActiQ9H310 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132677 Expressed in right hemisphere of cerebellum and 79 other tissues
ExpressionAtlasiQ9H310 baseline and differential
GenevisibleiQ9H310 HS

Family and domain databases

Gene3Di1.10.3430.10, 1 hit
InterProiView protein in InterPro
IPR029020 Ammonium/urea_transptr
IPR024041 NH4_transpt_AmtB-like_dom
IPR002229 RhesusRHD
PfamiView protein in Pfam
PF00909 Ammonium_transp, 1 hit
PRINTSiPR00342 RHESUSRHD

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHBG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H310
Secondary accession number(s): A8K475
, Q5SZW4, Q5SZW6, Q5SZW7, Q6P193, Q6YJI2, Q6YJI3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 14, 2008
Last modified: February 26, 2020
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again