Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 12 member 5

Gene

SLC12A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates electroneutral potassium-chloride cotransport in mature neurons and is required for neuronal Cl- homeostasis. As major extruder of intracellular chloride, it establishes the low neuronal Cl- levels required for chloride influx after binding of GABA-A and glycine to their receptors, with subsequent hyperpolarization and neuronal inhibition (By similarity). Involved in the regulation of dendritic spine formation and maturation (PubMed:24668262).By similarity1 Publication

Miscellaneous

Inhibited by furosemide and bumetanide.

Activity regulationi

Inhibited by WNK3.1 Publication

GO - Molecular functioni

  • chloride transmembrane transporter activity Source: UniProtKB
  • potassium:chloride symporter activity Source: UniProtKB
  • protein kinase binding Source: ParkinsonsUK-UCL

GO - Biological processi

Keywordsi

Biological processIon transport, Potassium transport, Symport, Transport
LigandChloride, Potassium

Enzyme and pathway databases

ReactomeiR-HSA-426117 Cation-coupled Chloride cotransporters

Protein family/group databases

TCDBi2.A.30.1.18 the cation-chloride cotransporter (ccc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 12 member 5
Alternative name(s):
Electroneutral potassium-chloride cotransporter 2
K-Cl cotransporter 2
Short name:
hKCC2
Neuronal K-Cl cotransporter
Gene namesi
Name:SLC12A5
Synonyms:KCC2, KIAA1176
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000124140.12
HGNCiHGNC:13818 SLC12A5
MIMi606726 gene
neXtProtiNX_Q9H2X9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 133CytoplasmicSequence analysisAdd BLAST133
Transmembranei134 – 154HelicalSequence analysisAdd BLAST21
Transmembranei156 – 176HelicalSequence analysisAdd BLAST21
Topological domaini177 – 194CytoplasmicSequence analysisAdd BLAST18
Transmembranei195 – 215HelicalSequence analysisAdd BLAST21
Transmembranei217 – 237HelicalSequence analysisAdd BLAST21
Topological domaini238 – 254CytoplasmicSequence analysisAdd BLAST17
Transmembranei255 – 275HelicalSequence analysisAdd BLAST21
Transmembranei278 – 298HelicalSequence analysisAdd BLAST21
Topological domaini299 – 418CytoplasmicSequence analysisAdd BLAST120
Transmembranei419 – 439HelicalSequence analysisAdd BLAST21
Transmembranei459 – 479HelicalSequence analysisAdd BLAST21
Topological domaini480 – 496CytoplasmicSequence analysisAdd BLAST17
Transmembranei497 – 517HelicalSequence analysisAdd BLAST21
Transmembranei570 – 590HelicalSequence analysisAdd BLAST21
Topological domaini591 – 630CytoplasmicSequence analysisAdd BLAST40
Transmembranei631 – 651HelicalSequence analysisAdd BLAST21
Transmembranei848 – 868HelicalSequence analysisAdd BLAST21
Topological domaini869 – 1139CytoplasmicSequence analysisAdd BLAST271

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Epileptic encephalopathy, early infantile, 34 (EIEE34)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. EIEE34 is characterized by onset of refractory migrating focal seizures in infancy. Affected children show developmental regression and are severely impaired globally.
See also OMIM:616645
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075078311L → H in EIEE34; results in reduced chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225306EnsemblClinVar.1
Natural variantiVAR_075079426L → P in EIEE34; results in loss of chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225304EnsemblClinVar.1
Natural variantiVAR_075080551G → D in EIEE34; results in loss of chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225305EnsemblClinVar.1
Epilepsy, idiopathic generalized 14 (EIG14)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant form of idiopathic generalized epilepsy, a disorder characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Generalized seizures arise diffusely and simultaneously from both hemispheres of the brain. Seizure types include juvenile myoclonic seizures, absence seizures, and generalized tonic-clonic seizures.
See also OMIM:616685
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075081975R → H in EIG14; rare variant associated with disease susceptibility; results in reduced chloride transport; decreased localization at the cell surface; unable to induce cortical dendritic spines formation. 3 PublicationsCorresponds to variant dbSNP:rs142740233Ensembl.1
Natural variantiVAR_0750831072R → C in EIG14; rare variant associated with disease susceptibility; results in reduced chloride transport. 2 PublicationsCorresponds to variant dbSNP:rs548424453EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Epilepsy

Organism-specific databases

DisGeNETi57468
MalaCardsiSLC12A5
MIMi616645 phenotype
616685 phenotype
OpenTargetsiENSG00000124140
Orphaneti293181 Malignant migrating partial seizures of infancy
PharmGKBiPA37814

Chemistry databases

ChEMBLiCHEMBL1615384
DrugBankiDB00887 Bumetanide
DB00761 Potassium Chloride
GuidetoPHARMACOLOGYi972

Polymorphism and mutation databases

BioMutaiSLC12A5
DMDMi161784306

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001780341 – 1139Solute carrier family 12 member 5Add BLAST1139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei57PhosphothreonineBy similarity1
Glycosylationi442N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi833N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1045PhosphoserineBy similarity1
Modified residuei1048PhosphoserineBy similarity1
Modified residuei1049PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9H2X9
MaxQBiQ9H2X9
PaxDbiQ9H2X9
PeptideAtlasiQ9H2X9
PRIDEiQ9H2X9
ProteomicsDBi80632
80633 [Q9H2X9-2]

PTM databases

iPTMnetiQ9H2X9
PhosphoSitePlusiQ9H2X9
SwissPalmiQ9H2X9

Expressioni

Tissue specificityi

Brain specific. Detected in neuronal cells.

Gene expression databases

BgeeiENSG00000124140 Expressed in 132 organ(s), highest expression level in caudate nucleus
CleanExiHS_SLC12A5
ExpressionAtlasiQ9H2X9 baseline and differential
GenevisibleiQ9H2X9 HS

Organism-specific databases

HPAiHPA072058

Interactioni

Subunit structurei

Homomultimer and heteromultimer with other K-Cl cotransporters. Interacts with AP2A1 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121538, 2 interactors
STRINGi9606.ENSP00000387694

Chemistry databases

BindingDBiQ9H2X9

Structurei

3D structure databases

ProteinModelPortaliQ9H2X9
SMRiQ9H2X9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SLC12A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2082 Eukaryota
COG0531 LUCA
GeneTreeiENSGT00760000119053
HOGENOMiHOG000092644
HOVERGENiHBG052852
InParanoidiQ9H2X9
KOiK14427
OMAiEAFCMVF
OrthoDBiEOG091G0WB4
PhylomeDBiQ9H2X9
TreeFamiTF313657

Family and domain databases

InterProiView protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR030358 KCC2
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam
PANTHERiPTHR11827:SF54 PTHR11827:SF54, 1 hit
PfamiView protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 3 hits
PRINTSiPR01081 KCLTRNSPORT
TIGRFAMsiTIGR00930 2a30, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H2X9-1) [UniParc]FASTAAdd to basket
Also known as: KCC2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRFTVTSL PPAGPARSPD PESRRHSVAD PRHLPGEDVK GDGNPKESSP
60 70 80 90 100
FINSTDTEKG KEYDGKNMAL FEEEMDTSPM VSSLLSGLAN YTNLPQGSRE
110 120 130 140 150
HEEAENNEGG KKKPVQAPRM GTFMGVYLPC LQNIFGVILF LRLTWVVGIA
160 170 180 190 200
GIMESFCMVF ICCSCTMLTA ISMSAIATNG VVPAGGSYYM ISRSLGPEFG
210 220 230 240 250
GAVGLCFYLG TTFAGAMYIL GTIEILLAYL FPAMAIFKAE DASGEAAAML
260 270 280 290 300
NNMRVYGTCV LTCMATVVFV GVKYVNKFAL VFLGCVILSI LAIYAGVIKS
310 320 330 340 350
AFDPPNFPIC LLGNRTLSRH GFDVCAKLAW EGNETVTTRL WGLFCSSRFL
360 370 380 390 400
NATCDEYFTR NNVTEIQGIP GAASGLIKEN LWSSYLTKGV IVERSGMTSV
410 420 430 440 450
GLADGTPIDM DHPYVFSDMT SYFTLLVGIY FPSVTGIMAG SNRSGDLRDA
460 470 480 490 500
QKSIPTGTIL AIATTSAVYI SSVVLFGACI EGVVLRDKFG EAVNGNLVVG
510 520 530 540 550
TLAWPSPWVI VIGSFFSTCG AGLQSLTGAP RLLQAISRDG IVPFLQVFGH
560 570 580 590 600
GKANGEPTWA LLLTACICEI GILIASLDEV APILSMFFLM CYMFVNLACA
610 620 630 640 650
VQTLLRTPNW RPRFRYYHWT LSFLGMSLCL ALMFICSWYY ALVAMLIAGL
660 670 680 690 700
IYKYIEYRGA EKEWGDGIRG LSLSAARYAL LRLEEGPPHT KNWRPQLLVL
710 720 730 740 750
VRVDQDQNVV HPQLLSLTSQ LKAGKGLTIV GSVLEGTFLE NHPQAQRAEE
760 770 780 790 800
SIRRLMEAEK VKGFCQVVIS SNLRDGVSHL IQSGGLGGLQ HNTVLVGWPR
810 820 830 840 850
NWRQKEDHQT WRNFIELVRE TTAGHLALLV TKNVSMFPGN PERFSEGSID
860 870 880 890 900
VWWIVHDGGM LMLLPFLLRH HKVWRKCKMR IFTVAQMDDN SIQMKKDLTT
910 920 930 940 950
FLYHLRITAE VEVVEMHESD ISAYTYEKTL VMEQRSQILK QMHLTKNERE
960 970 980 990 1000
REIQSITDES RGSIRRKNPA NTRLRLNVPE ETAGDSEEKP EEEVQLIHDQ
1010 1020 1030 1040 1050
SAPSCPSSSP SPGEEPEGEG ETDPEKVHLT WTKDKSVAEK NKGPSPVSSE
1060 1070 1080 1090 1100
GIKDFFSMKP EWENLNQSNV RRMHTAVRLN EVIVKKSRDA KLVLLNMPGP
1110 1120 1130
PRNRNGDENY MEFLEVLTEH LDRVMLVRGG GREVITIYS
Length:1,139
Mass (Da):126,184
Last modified:December 4, 2007 - v3
Checksum:i100C097AF1FD4B3E
GO
Isoform 2 (identifier: Q9H2X9-2) [UniParc]FASTAAdd to basket
Also known as: KCC2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVK → MLNNLTDCEDGDGGANP

Show »
Length:1,116
Mass (Da):123,511
Checksum:i68D46DECF8592FCF
GO

Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z3T3B7Z3T3_HUMAN
cDNA FLJ59167, highly similar to So...
SLC12A5
186Annotation score:
M4PM71M4PM71_HUMAN
KCC2 transcript variant 7
SLC12A5
289Annotation score:
M4PNB5M4PNB5_HUMAN
KCC2 transcript variant 3
SLC12A5
262Annotation score:
A0A087X201A0A087X201_HUMAN
Solute carrier family 12 member 5
SLC12A5
459Annotation score:
M4PNC0M4PNC0_HUMAN
KCC2 transcript variant 8
SLC12A5
180Annotation score:
V9GYL3V9GYL3_HUMAN
Solute carrier family 12 member 5
SLC12A5
123Annotation score:
A0A0D9SGF9A0A0D9SGF9_HUMAN
Solute carrier family 12 member 5
SLC12A5
58Annotation score:
A0A0D9SGD0A0A0D9SGD0_HUMAN
HCG1821261
SLC12A5 hCG_1821261
120Annotation score:
A0A0D9SF89A0A0D9SF89_HUMAN
Solute carrier family 12 member 5
SLC12A5
53Annotation score:
A0A0D9SGA5A0A0D9SGA5_HUMAN
Solute carrier family 12 member 5
SLC12A5
67Annotation score:
There is more potential isoformShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q9H2X9-2)
Sequence conflicti2L → P in AAG43493 (PubMed:12106695).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075078311L → H in EIEE34; results in reduced chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225306EnsemblClinVar.1
Natural variantiVAR_027414407P → A. Corresponds to variant dbSNP:rs16985442Ensembl.1
Natural variantiVAR_075079426L → P in EIEE34; results in loss of chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225304EnsemblClinVar.1
Natural variantiVAR_075080551G → D in EIEE34; results in loss of chloride transport; decreased localization at the cell surface. 1 PublicationCorresponds to variant dbSNP:rs863225305EnsemblClinVar.1
Natural variantiVAR_036557847G → D in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_075081975R → H in EIG14; rare variant associated with disease susceptibility; results in reduced chloride transport; decreased localization at the cell surface; unable to induce cortical dendritic spines formation. 3 PublicationsCorresponds to variant dbSNP:rs142740233Ensembl.1
Natural variantiVAR_0750821071R → W1 PublicationCorresponds to variant dbSNP:rs369042030Ensembl.1
Natural variantiVAR_0750831072R → C in EIG14; rare variant associated with disease susceptibility; results in reduced chloride transport. 2 PublicationsCorresponds to variant dbSNP:rs548424453EnsemblClinVar.1
Natural variantiVAR_0249941100P → L1 PublicationCorresponds to variant dbSNP:rs17297532Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0299091 – 40MSRRF…GEDVK → MLNNLTDCEDGDGGANP in isoform 2. 3 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF208159 mRNA Translation: AAG43493.1
AL162458 Genomic DNA No translation available.
BC132668 mRNA Translation: AAI32669.1
BC132670 mRNA Translation: AAI32671.1
AB033002 mRNA Translation: BAA86490.1
DA102113 mRNA No translation available.
DA328785 mRNA No translation available.
CCDSiCCDS13391.1 [Q9H2X9-2]
CCDS46610.1 [Q9H2X9-1]
RefSeqiNP_001128243.1, NM_001134771.1 [Q9H2X9-1]
NP_065759.1, NM_020708.4 [Q9H2X9-2]
UniGeneiHs.21413

Genome annotation databases

EnsembliENST00000243964; ENSP00000243964; ENSG00000124140 [Q9H2X9-2]
ENST00000454036; ENSP00000387694; ENSG00000124140 [Q9H2X9-1]
GeneIDi57468
KEGGihsa:57468
UCSCiuc002xrb.3 human [Q9H2X9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF208159 mRNA Translation: AAG43493.1
AL162458 Genomic DNA No translation available.
BC132668 mRNA Translation: AAI32669.1
BC132670 mRNA Translation: AAI32671.1
AB033002 mRNA Translation: BAA86490.1
DA102113 mRNA No translation available.
DA328785 mRNA No translation available.
CCDSiCCDS13391.1 [Q9H2X9-2]
CCDS46610.1 [Q9H2X9-1]
RefSeqiNP_001128243.1, NM_001134771.1 [Q9H2X9-1]
NP_065759.1, NM_020708.4 [Q9H2X9-2]
UniGeneiHs.21413

3D structure databases

ProteinModelPortaliQ9H2X9
SMRiQ9H2X9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121538, 2 interactors
STRINGi9606.ENSP00000387694

Chemistry databases

BindingDBiQ9H2X9
ChEMBLiCHEMBL1615384
DrugBankiDB00887 Bumetanide
DB00761 Potassium Chloride
GuidetoPHARMACOLOGYi972

Protein family/group databases

TCDBi2.A.30.1.18 the cation-chloride cotransporter (ccc) family

PTM databases

iPTMnetiQ9H2X9
PhosphoSitePlusiQ9H2X9
SwissPalmiQ9H2X9

Polymorphism and mutation databases

BioMutaiSLC12A5
DMDMi161784306

Proteomic databases

EPDiQ9H2X9
MaxQBiQ9H2X9
PaxDbiQ9H2X9
PeptideAtlasiQ9H2X9
PRIDEiQ9H2X9
ProteomicsDBi80632
80633 [Q9H2X9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243964; ENSP00000243964; ENSG00000124140 [Q9H2X9-2]
ENST00000454036; ENSP00000387694; ENSG00000124140 [Q9H2X9-1]
GeneIDi57468
KEGGihsa:57468
UCSCiuc002xrb.3 human [Q9H2X9-1]

Organism-specific databases

CTDi57468
DisGeNETi57468
EuPathDBiHostDB:ENSG00000124140.12
GeneCardsiSLC12A5
HGNCiHGNC:13818 SLC12A5
HPAiHPA072058
MalaCardsiSLC12A5
MIMi606726 gene
616645 phenotype
616685 phenotype
neXtProtiNX_Q9H2X9
OpenTargetsiENSG00000124140
Orphaneti293181 Malignant migrating partial seizures of infancy
PharmGKBiPA37814
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2082 Eukaryota
COG0531 LUCA
GeneTreeiENSGT00760000119053
HOGENOMiHOG000092644
HOVERGENiHBG052852
InParanoidiQ9H2X9
KOiK14427
OMAiEAFCMVF
OrthoDBiEOG091G0WB4
PhylomeDBiQ9H2X9
TreeFamiTF313657

Enzyme and pathway databases

ReactomeiR-HSA-426117 Cation-coupled Chloride cotransporters

Miscellaneous databases

GeneWikiiChloride_potassium_symporter_5
GenomeRNAii57468
PROiPR:Q9H2X9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124140 Expressed in 132 organ(s), highest expression level in caudate nucleus
CleanExiHS_SLC12A5
ExpressionAtlasiQ9H2X9 baseline and differential
GenevisibleiQ9H2X9 HS

Family and domain databases

InterProiView protein in InterPro
IPR004841 AA-permease/SLC12A_dom
IPR030358 KCC2
IPR000076 KCL_cotranspt
IPR018491 SLC12_C
IPR004842 SLC12A_fam
PANTHERiPTHR11827:SF54 PTHR11827:SF54, 1 hit
PfamiView protein in Pfam
PF00324 AA_permease, 2 hits
PF03522 SLC12, 3 hits
PRINTSiPR01081 KCLTRNSPORT
TIGRFAMsiTIGR00930 2a30, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiS12A5_HUMAN
AccessioniPrimary (citable) accession number: Q9H2X9
Secondary accession number(s): A2RTX2
, Q5VZ41, Q9H4Z0, Q9ULP4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 13, 2002
Last sequence update: December 4, 2007
Last modified: November 7, 2018
This is version 152 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again