Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Diphthine methyl ester synthase

Gene

DPH5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

S-adenosyl-L-methionine-dependent methyltransferase that catalyzes four methylations of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine methyl ester. The four successive methylation reactions represent the second step of diphthamide biosynthesis.By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: peptidyl-diphthamide biosynthesis

This protein is involved in the pathway peptidyl-diphthamide biosynthesis, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway peptidyl-diphthamide biosynthesis and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei9S-adenosyl-L-methionine; via carbonyl oxygenBy similarity1
Binding sitei84S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei87S-adenosyl-L-methionine; via carbonyl oxygenBy similarity1
Binding sitei163S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei225S-adenosyl-L-methionine; via amide nitrogen and carbonyl oxygenBy similarity1
Binding sitei250S-adenosyl-L-methionine; via carbonyl oxygenBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5358493 Synthesis of diphthamide-EEF2

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00559

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Diphthine methyl ester synthase (EC:2.1.1.314)
Alternative name(s):
Diphthamide biosynthesis methyltransferase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DPH5
ORF Names:AD-018, CGI-30, HSPC143, NPD015
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000117543.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24270 DPH5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611075 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H2P9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000117543

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671956

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01752 S-Adenosyl-L-Homocysteine

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DPH5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
46397414

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001561331 – 285Diphthine methyl ester synthaseAdd BLAST285

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei171PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H2P9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H2P9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H2P9

PeptideAtlas

More...
PeptideAtlasi
Q9H2P9

PRoteomics IDEntifications database

More...
PRIDEi
Q9H2P9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
80572
80573 [Q9H2P9-2]
80574 [Q9H2P9-3]
80575 [Q9H2P9-4]
80576 [Q9H2P9-5]
80577 [Q9H2P9-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H2P9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H2P9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000117543 Expressed in 227 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_DPH5

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H2P9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H2P9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046439
HPA076234

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119637, 13 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359127

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9H2P9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H2P9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni112 – 113S-adenosyl-L-methionine bindingBy similarity2

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the diphthine synthase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3123 Eukaryota
COG1798 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010568

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000205302

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG044879

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H2P9

KEGG Orthology (KO)

More...
KOi
K00586

Identification of Orthologs from Complete Genome Data

More...
OMAi
LQNYRFG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0EKA

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H2P9

TreeFam database of animal gene trees

More...
TreeFami
TF105603

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11647 Diphthine_synthase, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.950.10, 1 hit
3.40.1010.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_01084 Diphthine_synth, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000878 4pyrrol_Mease
IPR035996 4pyrrol_Methylase_sf
IPR014777 4pyrrole_Mease_sub1
IPR014776 4pyrrole_Mease_sub2
IPR004551 Dphthn_synthase

The PANTHER Classification System

More...
PANTHERi
PTHR10882:SF0 PTHR10882:SF0, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00590 TP_methylase, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF036432 Diphthine_synth, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53790 SSF53790, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00522 dph5, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H2P9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLYLIGLGLG DAKDITVKGL EVVRRCSRVY LEAYTSVLTV GKEALEEFYG
60 70 80 90 100
RKLVVADREE VEQEADNILK DADISDVAFL VVGDPFGATT HSDLVLRATK
110 120 130 140 150
LGIPYRVIHN ASIMNAVGCC GLQLYKFGET VSIVFWTDTW RPESFFDKVK
160 170 180 190 200
KNRQNGMHTL CLLDIKVKEQ SLENLIKGRK IYEPPRYMSV NQAAQQLLEI
210 220 230 240 250
VQNQRIRGEE PAVTEETLCV GLARVGADDQ KIAAGTLRQM CTVDLGEPLH
260 270 280
SLIITGGSIH PMEMEMLSLF SIPENSSESQ SINGL
Length:285
Mass (Da):31,651
Last modified:October 10, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1348631C25BC624E
GO
Isoform 2 (identifier: Q9H2P9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     85-137: PFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWT → HL

Note: No experimental confirmation available.
Show »
Length:234
Mass (Da):26,122
Checksum:iCAA1ABE0A11AF714
GO
Isoform 3 (identifier: Q9H2P9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-143: ATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPE → HLETR

Note: No experimental confirmation available.
Show »
Length:234
Mass (Da):26,025
Checksum:i86A9E6761145DFBA
GO
Isoform 4 (identifier: Q9H2P9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-141: VGCCGLQLYKFGETVSIVFWTDTWR → EAAGGYRYISLERQVLLVFGQTLGG

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):31,440
Checksum:i2784D835EB96EFC2
GO
Isoform 5 (identifier: Q9H2P9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     134-137: VFWT → MLISVMLHSLWLVIHL

Note: No experimental confirmation available.
Show »
Length:297
Mass (Da):33,005
Checksum:iE0D27EEEF0B9849D
GO
Isoform 6 (identifier: Q9H2P9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-212: Missing.

Note: No experimental confirmation available.
Show »
Length:284
Mass (Da):31,580
Checksum:i862A9762E32AA574
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q96DC6Q96DC6_HUMAN
DPH5 homolog (S. cerevisiae), isofo...
DPH5 hCG_32849
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti107V → G in AAG44563 (Ref. 4) Curated1
Sequence conflicti285L → FEHRYFHCLM in AAF67485 (PubMed:10931946).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00850885 – 137PFGAT…IVFWT → HL in isoform 2. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_00850988 – 143ATTHS…TWRPE → HLETR in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_008510117 – 141VGCCG…TDTWR → EAAGGYRYISLERQVLLVFG QTLGG in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_008511134 – 137VFWT → MLISVMLHSLWLVIHL in isoform 5. 1 Publication4
Alternative sequenceiVSP_043444212Missing in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF132964 mRNA Translation: AAD27739.1
AF157319 mRNA Translation: AAF67485.1
AF161492 mRNA Translation: AAF29107.1
AF248965 mRNA Translation: AAG44563.1
AK289351 mRNA Translation: BAF82040.1
AC093157 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72933.1
CH471097 Genomic DNA Translation: EAW72937.1
CH471097 Genomic DNA Translation: EAW72938.1
CH471097 Genomic DNA Translation: EAW72940.1
BC053857 mRNA Translation: AAH53857.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41358.1 [Q9H2P9-1]
CCDS41359.1 [Q9H2P9-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001070862.1, NM_001077394.1 [Q9H2P9-1]
NP_001070863.1, NM_001077395.1 [Q9H2P9-6]
NP_057042.2, NM_015958.2 [Q9H2P9-1]
XP_016856949.1, XM_017001460.1 [Q9H2P9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.440776

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000342173; ENSP00000339630; ENSG00000117543 [Q9H2P9-6]
ENST00000370109; ENSP00000359127; ENSG00000117543 [Q9H2P9-1]
ENST00000488176; ENSP00000418282; ENSG00000117543 [Q9H2P9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51611

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51611

UCSC genome browser

More...
UCSCi
uc001dtr.4 human [Q9H2P9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132964 mRNA Translation: AAD27739.1
AF157319 mRNA Translation: AAF67485.1
AF161492 mRNA Translation: AAF29107.1
AF248965 mRNA Translation: AAG44563.1
AK289351 mRNA Translation: BAF82040.1
AC093157 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72933.1
CH471097 Genomic DNA Translation: EAW72937.1
CH471097 Genomic DNA Translation: EAW72938.1
CH471097 Genomic DNA Translation: EAW72940.1
BC053857 mRNA Translation: AAH53857.1
CCDSiCCDS41358.1 [Q9H2P9-1]
CCDS41359.1 [Q9H2P9-6]
RefSeqiNP_001070862.1, NM_001077394.1 [Q9H2P9-1]
NP_001070863.1, NM_001077395.1 [Q9H2P9-6]
NP_057042.2, NM_015958.2 [Q9H2P9-1]
XP_016856949.1, XM_017001460.1 [Q9H2P9-1]
UniGeneiHs.440776

3D structure databases

ProteinModelPortaliQ9H2P9
SMRiQ9H2P9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119637, 13 interactors
STRINGi9606.ENSP00000359127

Chemistry databases

DrugBankiDB01752 S-Adenosyl-L-Homocysteine

PTM databases

iPTMnetiQ9H2P9
PhosphoSitePlusiQ9H2P9

Polymorphism and mutation databases

BioMutaiDPH5
DMDMi46397414

Proteomic databases

EPDiQ9H2P9
MaxQBiQ9H2P9
PaxDbiQ9H2P9
PeptideAtlasiQ9H2P9
PRIDEiQ9H2P9
ProteomicsDBi80572
80573 [Q9H2P9-2]
80574 [Q9H2P9-3]
80575 [Q9H2P9-4]
80576 [Q9H2P9-5]
80577 [Q9H2P9-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342173; ENSP00000339630; ENSG00000117543 [Q9H2P9-6]
ENST00000370109; ENSP00000359127; ENSG00000117543 [Q9H2P9-1]
ENST00000488176; ENSP00000418282; ENSG00000117543 [Q9H2P9-1]
GeneIDi51611
KEGGihsa:51611
UCSCiuc001dtr.4 human [Q9H2P9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51611
EuPathDBiHostDB:ENSG00000117543.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DPH5

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0023161
HGNCiHGNC:24270 DPH5
HPAiHPA046439
HPA076234
MIMi611075 gene
neXtProtiNX_Q9H2P9
OpenTargetsiENSG00000117543
PharmGKBiPA142671956

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3123 Eukaryota
COG1798 LUCA
GeneTreeiENSGT00390000010568
HOGENOMiHOG000205302
HOVERGENiHBG044879
InParanoidiQ9H2P9
KOiK00586
OMAiLQNYRFG
OrthoDBiEOG091G0EKA
PhylomeDBiQ9H2P9
TreeFamiTF105603

Enzyme and pathway databases

UniPathwayi
UPA00559

ReactomeiR-HSA-5358493 Synthesis of diphthamide-EEF2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DPH5 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DPH5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51611

Protein Ontology

More...
PROi
PR:Q9H2P9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000117543 Expressed in 227 organ(s), highest expression level in testis
CleanExiHS_DPH5
ExpressionAtlasiQ9H2P9 baseline and differential
GenevisibleiQ9H2P9 HS

Family and domain databases

CDDicd11647 Diphthine_synthase, 1 hit
Gene3Di3.30.950.10, 1 hit
3.40.1010.10, 1 hit
HAMAPiMF_01084 Diphthine_synth, 1 hit
InterProiView protein in InterPro
IPR000878 4pyrrol_Mease
IPR035996 4pyrrol_Methylase_sf
IPR014777 4pyrrole_Mease_sub1
IPR014776 4pyrrole_Mease_sub2
IPR004551 Dphthn_synthase
PANTHERiPTHR10882:SF0 PTHR10882:SF0, 1 hit
PfamiView protein in Pfam
PF00590 TP_methylase, 1 hit
PIRSFiPIRSF036432 Diphthine_synth, 1 hit
SUPFAMiSSF53790 SSF53790, 1 hit
TIGRFAMsiTIGR00522 dph5, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDPH5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H2P9
Secondary accession number(s): A8JZY6
, D3DT62, Q9P017, Q9P0I4, Q9Y319
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: October 10, 2003
Last modified: December 5, 2018
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again