Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-dependent neutral amino acid transporter B(0)AT2

Gene

SLC6A15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Functions as a sodium-dependent neutral amino acid transporter. Exhibits preference for the branched-chain amino acids, particularly leucine, valine and isoleucine and methionine. Mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. May have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent.1 Publication

Kineticsi

  1. KM=0.16 mM for L-leucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  2. KM=0.16 mM for L-valine (at pH 7.5, 100 mM NaCL, -70 mV))1 Publication
  3. KM=0.08 mM for L-isoleucine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  4. KM=0.11 mM for L-methionine (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication
  5. KM=0.38 mM for L-proline (at pH 7.5, 100 mM NaCL, -70 mV)1 Publication

    pH dependencei

    Optimum pH is 7.5-8.5. Strongly inhibited at acidic PH.1 Publication

    GO - Molecular functioni

    GO - Biological processi

    • amino acid transport Source: Reactome
    • leucine transport Source: UniProtKB
    • neurotransmitter transport Source: UniProtKB
    • neutral amino acid transport Source: UniProtKB
    • proline transport Source: UniProtKB

    Keywordsi

    Biological processAmino-acid transport, Ion transport, Neurotransmitter transport, Sodium transport, Symport, Transport
    LigandSodium

    Enzyme and pathway databases

    ReactomeiR-HSA-352230 Amino acid transport across the plasma membrane
    R-HSA-442660 Na+/Cl- dependent neurotransmitter transporters

    Protein family/group databases

    TCDBi2.A.22.6.7 the neurotransmitter:sodium symporter (nss) family

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sodium-dependent neutral amino acid transporter B(0)AT2
    Alternative name(s):
    Sodium- and chloride-dependent neurotransmitter transporter NTT73
    Sodium-coupled branched-chain amino-acid transporter 1
    Solute carrier family 6 member 15
    Transporter v7-3
    Gene namesi
    Name:SLC6A15
    Synonyms:B0AT2, NTT73, SBAT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    Proteomesi
    • UP000005640 Componenti: Chromosome 12

    Organism-specific databases

    EuPathDBiHostDB:ENSG00000072041.16
    HGNCiHGNC:13621 SLC6A15
    MIMi607971 gene
    neXtProtiNX_Q9H2J7

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Topological domaini1 – 69CytoplasmicSequence analysisAdd BLAST69
    Transmembranei70 – 90Helical; Name=1Sequence analysisAdd BLAST21
    Transmembranei98 – 117Helical; Name=2Sequence analysisAdd BLAST20
    Transmembranei142 – 162Helical; Name=3Sequence analysisAdd BLAST21
    Topological domaini163 – 225ExtracellularSequence analysisAdd BLAST63
    Transmembranei226 – 244Helical; Name=4Sequence analysisAdd BLAST19
    Transmembranei253 – 270Helical; Name=5Sequence analysisAdd BLAST18
    Transmembranei306 – 323Helical; Name=6Sequence analysisAdd BLAST18
    Transmembranei335 – 356Helical; Name=7Sequence analysisAdd BLAST22
    Topological domaini357 – 452ExtracellularSequence analysisAdd BLAST96
    Transmembranei453 – 472Helical; Name=8Sequence analysisAdd BLAST20
    Transmembranei496 – 514Helical; Name=9Sequence analysisAdd BLAST19
    Transmembranei530 – 550Helical; Name=10Sequence analysisAdd BLAST21
    Transmembranei571 – 592Helical; Name=11Sequence analysisAdd BLAST22
    Transmembranei620 – 642Helical; Name=12Sequence analysisAdd BLAST23
    Topological domaini643 – 730CytoplasmicSequence analysisAdd BLAST88

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    DisGeNETi55117
    OpenTargetsiENSG00000072041
    PharmGKBiPA37799

    Chemistry databases

    ChEMBLiCHEMBL3351189
    GuidetoPHARMACOLOGYi940

    Polymorphism and mutation databases

    BioMutaiSLC6A15
    DMDMi18202939

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00002147981 – 730Sodium-dependent neutral amino acid transporter B(0)AT2Add BLAST730

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei25PhosphoserineCombined sources1
    Modified residuei55PhosphoserineCombined sources1
    Glycosylationi187N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi213N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi394N-linked (GlcNAc...) asparagineSequence analysis1
    Modified residuei687PhosphoserineCombined sources1
    Modified residuei699PhosphoserineCombined sources1
    Modified residuei701PhosphoserineCombined sources1

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    EPDiQ9H2J7
    MaxQBiQ9H2J7
    PaxDbiQ9H2J7
    PeptideAtlasiQ9H2J7
    PRIDEiQ9H2J7
    ProteomicsDBi80556
    80557 [Q9H2J7-2]

    PTM databases

    iPTMnetiQ9H2J7
    PhosphoSitePlusiQ9H2J7

    Expressioni

    Tissue specificityi

    Almost exclusively expressed in the brain.1 Publication

    Gene expression databases

    BgeeiENSG00000072041
    CleanExiHS_SLC6A15
    ExpressionAtlasiQ9H2J7 baseline and differential
    GenevisibleiQ9H2J7 HS

    Organism-specific databases

    HPAiHPA008609

    Interactioni

    Protein-protein interaction databases

    BioGridi120426, 31 interactors
    IntActiQ9H2J7, 10 interactors
    STRINGi9606.ENSP00000266682

    Chemistry databases

    BindingDBiQ9H2J7

    Structurei

    3D structure databases

    ProteinModelPortaliQ9H2J7
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG3659 Eukaryota
    COG0733 LUCA
    GeneTreeiENSGT00760000119044
    HOGENOMiHOG000116406
    HOVERGENiHBG071421
    InParanoidiQ9H2J7
    KOiK05048
    OMAiIPHHINF
    OrthoDBiEOG091G08PX
    PhylomeDBiQ9H2J7
    TreeFamiTF352709

    Family and domain databases

    InterProiView protein in InterPro
    IPR000175 Na/ntran_symport
    IPR002438 Na/ntran_symport_orphan
    IPR037272 SNS_sf
    PANTHERiPTHR11616 PTHR11616, 1 hit
    PfamiView protein in Pfam
    PF00209 SNF, 1 hit
    PRINTSiPR00176 NANEUSMPORT
    PR01206 ORPHTRNSPORT
    SUPFAMiSSF161070 SSF161070, 2 hits
    PROSITEiView protein in PROSITE
    PS00610 NA_NEUROTRAN_SYMP_1, 1 hit
    PS00754 NA_NEUROTRAN_SYMP_2, 1 hit
    PS50267 NA_NEUROTRAN_SYMP_3, 1 hit

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9H2J7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MPKNSKVVKR ELDDDVTESV KDLLSNEDAA DDAFKTSELI VDGQEEKDTD
    60 70 80 90 100
    VEEGSEVEDE RPAWNSKLQY ILAQVGFSVG LGNVWRFPYL CQKNGGGAYL
    110 120 130 140 150
    LPYLILLMVI GIPLFFLELS VGQRIRRGSI GVWNYISPKL GGIGFASCVV
    160 170 180 190 200
    CYFVALYYNV IIGWSLFYFS QSFQQPLPWD QCPLVKNASH TFVEPECEQS
    210 220 230 240 250
    SATTYYWYRE ALNISSSISE SGGLNWKMTI CLLAAWVMVC LAMIKGIQSS
    260 270 280 290 300
    GKIIYFSSLF PYVVLICFLI RAFLLNGSID GIRHMFTPKL EIMLEPKVWR
    310 320 330 340 350
    EAATQVFFAL GLGFGGVIAF SSYNKRDNNC HFDAVLVSFI NFFTSVLATL
    360 370 380 390 400
    VVFAVLGFKA NVINEKCITQ NSETIMKFLK MGNISQDIIP HHINLSTVTA
    410 420 430 440 450
    EDYHLVYDII QKVKEEEFPA LHLNSCKIEE ELNKAVQGTG LAFIAFTEAM
    460 470 480 490 500
    THFPASPFWS VMFFLMLVNL GLGSMFGTIE GIVTPIVDTF KVRKEILTVI
    510 520 530 540 550
    CCLLAFCIGL IFVQRSGNYF VTMFDDYSAT LPLLIVVILE NIAVCFVYGI
    560 570 580 590 600
    DKFMEDLKDM LGFAPSRYYY YMWKYISPLM LLSLLIASVV NMGLSPPGYN
    610 620 630 640 650
    AWIEDKASEE FLSYPTWGLV VCVSLVVFAI LPVPVVFIVR RFNLIDDSSG
    660 670 680 690 700
    NLASVTYKRG RVLKEPVNLE GDDTSLIHGK IPSEMPSPNF GKNIYRKQSG
    710 720 730
    SPTLDTAPNG RYGIGYLMAD IMPDMPESDL
    Length:730
    Mass (Da):81,836
    Last modified:March 1, 2001 - v1
    Checksum:i45963118E06CFFE6
    GO
    Isoform 2 (identifier: Q9H2J7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         253-289: IIYFSSLFPYVVLICFLIRAFLLNGSIDGIRHMFTPK → VSMLEPFLILLITISGFIPLSNSVTDFCGQITHNTSF
         290-730: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:289
    Mass (Da):32,264
    Checksum:iAB0768CD8F74BF47
    GO
    Isoform 3 (identifier: Q9H2J7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:623
    Mass (Da):69,886
    Checksum:iDB10A517144B0643
    GO

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_052065400A → V1 PublicationCorresponds to variant dbSNP:rs12424429Ensembl.1
    Natural variantiVAR_052066603I → M. Corresponds to variant dbSNP:rs3782369Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0451921 – 107Missing in isoform 3. 1 PublicationAdd BLAST107
    Alternative sequenceiVSP_043030253 – 289IIYFS…MFTPK → VSMLEPFLILLITISGFIPL SNSVTDFCGQITHNTSF in isoform 2. 1 PublicationAdd BLAST37
    Alternative sequenceiVSP_043031290 – 730Missing in isoform 2. 1 PublicationAdd BLAST441

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF265577 mRNA Translation: AAG41361.1
    AK022853 mRNA Translation: BAB14274.1
    AK291207 mRNA Translation: BAF83896.1
    AK294945 mRNA Translation: BAH11933.1
    AC018922 Genomic DNA No translation available.
    AC128657 Genomic DNA No translation available.
    CH471054 Genomic DNA Translation: EAW97389.1
    BC070040 mRNA Translation: AAH70040.1
    CCDSiCCDS53816.1 [Q9H2J7-3]
    CCDS9026.1 [Q9H2J7-1]
    CCDS9027.1 [Q9H2J7-2]
    RefSeqiNP_001139807.1, NM_001146335.2 [Q9H2J7-3]
    NP_060527.2, NM_018057.6 [Q9H2J7-2]
    NP_877499.1, NM_182767.5 [Q9H2J7-1]
    UniGeneiHs.44424
    Hs.680104

    Genome annotation databases

    EnsembliENST00000266682; ENSP00000266682; ENSG00000072041 [Q9H2J7-1]
    ENST00000450363; ENSP00000390706; ENSG00000072041 [Q9H2J7-2]
    ENST00000552192; ENSP00000450145; ENSG00000072041 [Q9H2J7-3]
    GeneIDi55117
    KEGGihsa:55117
    UCSCiuc001szv.5 human [Q9H2J7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Similar proteinsi

    Entry informationi

    Entry nameiS6A15_HUMAN
    AccessioniPrimary (citable) accession number: Q9H2J7
    Secondary accession number(s): A8K592
    , B7Z2P7, E7ESJ5, Q9H9F5
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: March 1, 2001
    Last modified: June 20, 2018
    This is version 143 of the entry and version 1 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health