Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase-like 3

Gene

PPIL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

GO - Molecular functioni

GO - Biological processi

  • mRNA splicing, via spliceosome Source: UniProtKB
  • protein folding Source: InterPro

Keywordsi

Molecular functionIsomerase, Rotamase
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

BRENDAi5.2.1.8 2681
ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase-like 3 (EC:5.2.1.8)
Short name:
PPIase
Alternative name(s):
Cyclophilin J
Short name:
CyPJ
Cyclophilin-like protein PPIL3
Rotamase PPIL3
Gene namesi
Name:PPIL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000240344.8
HGNCiHGNC:9262 PPIL3
MIMi615811 gene
neXtProtiNX_Q9H2H8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Spliceosome

Pathology & Biotechi

Organism-specific databases

DisGeNETi53938
OpenTargetsiENSG00000240344
PharmGKBiPA33589

Polymorphism and mutation databases

BioMutaiPPIL3
DMDMi73921766

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000641662 – 161Peptidyl-prolyl cis-trans isomerase-like 3Add BLAST160

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei61Omega-N-methylarginineBy similarity1

Keywords - PTMi

Acetylation, Methylation

Proteomic databases

EPDiQ9H2H8
MaxQBiQ9H2H8
PeptideAtlasiQ9H2H8
PRIDEiQ9H2H8
ProteomicsDBi80550
80551 [Q9H2H8-2]
TopDownProteomicsiQ9H2H8-1 [Q9H2H8-1]

PTM databases

iPTMnetiQ9H2H8
PhosphoSitePlusiQ9H2H8

Expressioni

Tissue specificityi

Ubiquitous. Detected at low levels.1 Publication

Gene expression databases

BgeeiENSG00000240344 Expressed in 197 organ(s), highest expression level in endometrium
CleanExiHS_PPIL3
ExpressionAtlasiQ9H2H8 baseline and differential
GenevisibleiQ9H2H8 HS

Organism-specific databases

HPAiHPA040765
HPA062187

Interactioni

Subunit structurei

Identified in the spliceosome C complex.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi119820, 44 interactors
CORUMiQ9H2H8
IntActiQ9H2H8, 15 interactors
MINTiQ9H2H8

Structurei

Secondary structure

1161
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9H2H8
SMRiQ9H2H8
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9H2H8

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 154PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST153

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00760000119072
HOGENOMiHOG000065981
HOVERGENiHBG001065
InParanoidiQ9H2H8
KOiK12734
PhylomeDBiQ9H2H8
TreeFamiTF352224

Family and domain databases

Gene3Di2.40.100.10, 1 hit
InterProiView protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR024936 Cyclophilin-type_PPIase
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
PANTHERiPTHR11071 PTHR11071, 1 hit
PfamiView protein in Pfam
PF00160 Pro_isomerase, 1 hit
PIRSFiPIRSF001467 Peptidylpro_ismrse, 1 hit
PRINTSiPR00153 CSAPPISMRASE
SUPFAMiSSF50891 SSF50891, 1 hit
PROSITEiView protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H2H8-1) [UniParc]FASTAAdd to basket
Also known as: PPIL3b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVTLHTDVG DIKIEVFCER TPKTCENFLA LCASNYYNGC IFHRNIKGFM
60 70 80 90 100
VQTGDPTGTG RGGNSIWGKK FEDEYSEYLK HNVRGVVSMA NNGPNTNGSQ
110 120 130 140 150
FFITYGKQPH LDMKYTVFGK VIDGLETLDE LEKLPVNEKT YRPLNDVHIK
160
DITIHANPFA Q
Length:161
Mass (Da):18,155
Last modified:March 1, 2001 - v1
Checksum:i5FE190D7858B07D4
GO
Isoform 2 (identifier: Q9H2H8-2) [UniParc]FASTAAdd to basket
Also known as: PPIL3a

The sequence of this isoform differs from the canonical sequence as follows:
     27-58: NFLALCASNYYNGCIFHRNIKGFMVQTGDPTG → MESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPR

Show »
Length:165
Mass (Da):18,627
Checksum:iA533E5F757C18934
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZ14H7BZ14_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIL3
180Annotation score:
C9K058C9K058_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIL3
80Annotation score:
B8ZZ77B8ZZ77_HUMAN
Peptidyl-prolyl cis-trans isomerase
PPIL3
157Annotation score:
C9J4N2C9J4N2_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIL3
73Annotation score:
F8WC82F8WC82_HUMAN
Peptidyl-prolyl cis-trans isomerase...
PPIL3
53Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti61 – 62RG → KR in AAO64723 (Ref. 2) Curated2
Sequence conflicti65S → V in AAO64723 (Ref. 2) Curated1
Sequence conflicti78Y → I in AAO64723 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023417146D → E1 PublicationCorresponds to variant dbSNP:rs7562391Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01546827 – 58NFLAL…GDPTG → MESRCVPQAGVQWRDLGSLQ PPPPGFKQVFCLSLPR in isoform 2. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251049 mRNA Translation: AAK34939.1
AF271652 mRNA Translation: AAG44766.1
AF146799 mRNA Translation: AAO64723.1
AK027315 mRNA Translation: BAB55036.1
AC005037 Genomic DNA Translation: AAY14723.1
BC007693 mRNA Translation: AAH07693.1
CCDSiCCDS2332.1 [Q9H2H8-2]
CCDS2333.1 [Q9H2H8-1]
RefSeqiNP_115861.1, NM_032472.3 [Q9H2H8-2]
NP_570981.1, NM_130906.2 [Q9H2H8-1]
XP_005246708.1, XM_005246651.3 [Q9H2H8-2]
XP_005246709.1, XM_005246652.4 [Q9H2H8-1]
XP_011509660.1, XM_011511358.2 [Q9H2H8-1]
XP_016859841.1, XM_017004352.1 [Q9H2H8-2]
XP_016859842.1, XM_017004353.1 [Q9H2H8-2]
XP_016859843.1, XM_017004354.1 [Q9H2H8-2]
XP_016859844.1, XM_017004355.1 [Q9H2H8-1]
XP_016859845.1, XM_017004356.1 [Q9H2H8-1]
UniGeneiHs.121076

Genome annotation databases

EnsembliENST00000286175; ENSP00000286175; ENSG00000240344 [Q9H2H8-2]
ENST00000392283; ENSP00000376107; ENSG00000240344 [Q9H2H8-1]
ENST00000409449; ENSP00000387012; ENSG00000240344 [Q9H2H8-2]
GeneIDi53938
KEGGihsa:53938
UCSCiuc002uwh.4 human [Q9H2H8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251049 mRNA Translation: AAK34939.1
AF271652 mRNA Translation: AAG44766.1
AF146799 mRNA Translation: AAO64723.1
AK027315 mRNA Translation: BAB55036.1
AC005037 Genomic DNA Translation: AAY14723.1
BC007693 mRNA Translation: AAH07693.1
CCDSiCCDS2332.1 [Q9H2H8-2]
CCDS2333.1 [Q9H2H8-1]
RefSeqiNP_115861.1, NM_032472.3 [Q9H2H8-2]
NP_570981.1, NM_130906.2 [Q9H2H8-1]
XP_005246708.1, XM_005246651.3 [Q9H2H8-2]
XP_005246709.1, XM_005246652.4 [Q9H2H8-1]
XP_011509660.1, XM_011511358.2 [Q9H2H8-1]
XP_016859841.1, XM_017004352.1 [Q9H2H8-2]
XP_016859842.1, XM_017004353.1 [Q9H2H8-2]
XP_016859843.1, XM_017004354.1 [Q9H2H8-2]
XP_016859844.1, XM_017004355.1 [Q9H2H8-1]
XP_016859845.1, XM_017004356.1 [Q9H2H8-1]
UniGeneiHs.121076

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XYHX-ray2.60A1-161[»]
2OJUX-ray2.40A/B1-161[»]
2OK3X-ray2.00A1-161[»]
ProteinModelPortaliQ9H2H8
SMRiQ9H2H8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119820, 44 interactors
CORUMiQ9H2H8
IntActiQ9H2H8, 15 interactors
MINTiQ9H2H8

PTM databases

iPTMnetiQ9H2H8
PhosphoSitePlusiQ9H2H8

Polymorphism and mutation databases

BioMutaiPPIL3
DMDMi73921766

Proteomic databases

EPDiQ9H2H8
MaxQBiQ9H2H8
PeptideAtlasiQ9H2H8
PRIDEiQ9H2H8
ProteomicsDBi80550
80551 [Q9H2H8-2]
TopDownProteomicsiQ9H2H8-1 [Q9H2H8-1]

Protocols and materials databases

DNASUi53938
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000286175; ENSP00000286175; ENSG00000240344 [Q9H2H8-2]
ENST00000392283; ENSP00000376107; ENSG00000240344 [Q9H2H8-1]
ENST00000409449; ENSP00000387012; ENSG00000240344 [Q9H2H8-2]
GeneIDi53938
KEGGihsa:53938
UCSCiuc002uwh.4 human [Q9H2H8-1]

Organism-specific databases

CTDi53938
DisGeNETi53938
EuPathDBiHostDB:ENSG00000240344.8
GeneCardsiPPIL3
HGNCiHGNC:9262 PPIL3
HPAiHPA040765
HPA062187
MIMi615811 gene
neXtProtiNX_Q9H2H8
OpenTargetsiENSG00000240344
PharmGKBiPA33589
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119072
HOGENOMiHOG000065981
HOVERGENiHBG001065
InParanoidiQ9H2H8
KOiK12734
PhylomeDBiQ9H2H8
TreeFamiTF352224

Enzyme and pathway databases

BRENDAi5.2.1.8 2681
ReactomeiR-HSA-72163 mRNA Splicing - Major Pathway

Miscellaneous databases

ChiTaRSiPPIL3 human
EvolutionaryTraceiQ9H2H8
GeneWikiiPPIL3
GenomeRNAii53938
PROiPR:Q9H2H8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000240344 Expressed in 197 organ(s), highest expression level in endometrium
CleanExiHS_PPIL3
ExpressionAtlasiQ9H2H8 baseline and differential
GenevisibleiQ9H2H8 HS

Family and domain databases

Gene3Di2.40.100.10, 1 hit
InterProiView protein in InterPro
IPR029000 Cyclophilin-like_dom_sf
IPR024936 Cyclophilin-type_PPIase
IPR020892 Cyclophilin-type_PPIase_CS
IPR002130 Cyclophilin-type_PPIase_dom
PANTHERiPTHR11071 PTHR11071, 1 hit
PfamiView protein in Pfam
PF00160 Pro_isomerase, 1 hit
PIRSFiPIRSF001467 Peptidylpro_ismrse, 1 hit
PRINTSiPR00153 CSAPPISMRASE
SUPFAMiSSF50891 SSF50891, 1 hit
PROSITEiView protein in PROSITE
PS00170 CSA_PPIASE_1, 1 hit
PS50072 CSA_PPIASE_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPPIL3_HUMAN
AccessioniPrimary (citable) accession number: Q9H2H8
Secondary accession number(s): Q86WF9, Q96IA9, Q9BXZ1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: March 1, 2001
Last modified: September 12, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again