Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enhancer of polycomb homolog 1

Gene

EPC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.1 Publication

GO - Biological processi

Keywordsi

Molecular functionActivator, Chromatin regulator
Biological processGrowth regulation, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-8953750 Transcriptional Regulation by E2F6

Names & Taxonomyi

Protein namesi
Recommended name:
Enhancer of polycomb homolog 1
Gene namesi
Name:EPC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000120616.15
HGNCiHGNC:19876 EPC1
MIMi610999 gene
neXtProtiNX_Q9H2F5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi80314
OpenTargetsiENSG00000120616
PharmGKBiPA134981141

Polymorphism and mutation databases

DMDMi59797889

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002141531 – 836Enhancer of polycomb homolog 1Add BLAST836

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki319Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei539PhosphoserineCombined sources1
Cross-linki673Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9H2F5
MaxQBiQ9H2F5
PaxDbiQ9H2F5
PeptideAtlasiQ9H2F5
PRIDEiQ9H2F5
ProteomicsDBi80540
80541 [Q9H2F5-2]
80542 [Q9H2F5-3]

PTM databases

iPTMnetiQ9H2F5
PhosphoSitePlusiQ9H2F5
SwissPalmiQ9H2F5

Expressioni

Gene expression databases

BgeeiENSG00000120616 Expressed in 207 organ(s), highest expression level in secondary oocyte
GenevisibleiQ9H2F5 HS

Interactioni

Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. HTATTIP/TIP60, EPC1, and ING3 together constitute a minimal HAT complex termed Piccolo NuA4. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. The NuA4 complex interacts with MYC and the adenovirus E1A protein. EPC1 interacts with TRIM27.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi123227, 39 interactors
ComplexPortaliCPX-709 Piccolo NuA4 histone acetyltransferase complex
CPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H2F5
IntActiQ9H2F5, 16 interactors
MINTiQ9H2F5
STRINGi9606.ENSP00000263062

Structurei

3D structure databases

ProteinModelPortaliQ9H2F5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the enhancer of polycomb family.Curated

Phylogenomic databases

eggNOGiKOG2261 Eukaryota
ENOG410XSSX LUCA
GeneTreeiENSGT00390000013262
HOVERGENiHBG051489
InParanoidiQ9H2F5
KOiK11322
OMAiDYDSMFR
OrthoDBiEOG091G0252
PhylomeDBiQ9H2F5
TreeFamiTF106438

Family and domain databases

InterProiView protein in InterPro
IPR024943 Enhancer_polycomb
IPR019542 Enhancer_polycomb-like_N
IPR009607 Enhancer_polycomb_C
PANTHERiPTHR14898 PTHR14898, 1 hit
PfamiView protein in Pfam
PF06752 E_Pc_C, 1 hit
PF10513 EPL1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9H2F5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKLSFRARA LDASKPLPVF RCEDLPDLHE YASINRAVPQ MPTGMEKEEE
60 70 80 90 100
SEHHLQRAIS AQQVYGEKRD NMVIPVPEAE SNIAYYESIY PGEFKMPKQL
110 120 130 140 150
IHIQPFSLDA EQPDYDLDSE DEVFVNKLKK KMDICPLQFE EMIDRLEKGS
160 170 180 190 200
GQQPVSLQEA KLLLKEDDEL IREVYEYWIK KRKNCRGPSL IPSVKQEKRD
210 220 230 240 250
GSSTNDPYVA FRRRTEKMQT RKNRKNDEAS YEKMLKLRRD LSRAVTILEM
260 270 280 290 300
IKRREKSKRE LLHLTLEIME KRYNLGDYNG EIMSEVMAQR QPMKPTYAIP
310 320 330 340 350
IIPITNSSQF KHQEAMDVKE FKVNKQDKAD LIRPKRKYEK KPKVLPSSAA
360 370 380 390 400
ATPQQTSPAA LPVFNAKDLN QYDFPSSDEE PLSQVLSGSS EAEEDNDPDG
410 420 430 440 450
PFAFRRKAGC QYYAPHLDQT GNWPWTSPKD GGLGDVRYRY CLTTLTVPQR
460 470 480 490 500
CIGFARRRVG RGGRVLLDRA HSDYDSVFHH LDLEMLSSPQ HSPVNQFANT
510 520 530 540 550
SETNTSDKSF SKDLSQILVN IKSCRWRHFR PRTPSLHDSD NDELSCRKLY
560 570 580 590 600
RSINRTGTAQ PGTQTCSTST QSKSSSGSAH FAFTAEQYQQ HQQQLALMQK
610 620 630 640 650
QQLAQIQQQQ ANSNSSTNTS QNLASNQQKS GFRLNIQGLE RTLQGFVSKT
660 670 680 690 700
LDSASAQFAA SALVTSEQLM GFKMKDDVVL GIGVNGVLPA SGVYKGLHLS
710 720 730 740 750
STTPTALVHT SPSTAGSALL QPSNITQTSS SHSALSHQVT AANSATTQVL
760 770 780 790 800
IGNNIRLTVP SSVATVNSIA PINARHIPRT LSAVPSSALK LAAAANCQVS
810 820 830
KVPSSSSVDS VPRENHESEK PALNNIADNT VAMEVT
Length:836
Mass (Da):93,463
Last modified:March 1, 2001 - v1
Checksum:iE9E89699E73336B5
GO
Isoform 2 (identifier: Q9H2F5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-643: Missing.

Show »
Length:813
Mass (Da):90,865
Checksum:iAD6AE9D14C3020A7
GO
Isoform 3 (identifier: Q9H2F5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEES → M
     621-643: Missing.

Show »
Length:763
Mass (Da):85,222
Checksum:i9AAF6D3B2C0E3840
GO

Sequence cautioni

The sequence BAB14888 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC03857 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti156S → G in AAK60501 (Ref. 2) Curated1
Sequence conflicti256K → R in AAK60501 (Ref. 2) Curated1
Sequence conflicti783A → V in AAH36529 (PubMed:15489334).Curated1
Sequence conflicti825N → S in BAC03857 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_074181123V → L1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128751 – 51MSKLS…KEEES → M in isoform 3. 2 PublicationsAdd BLAST51
Alternative sequenceiVSP_012877621 – 643Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277374 mRNA Translation: AAG41402.1
AF286905 mRNA Translation: AAK60501.1
AK024329 mRNA Translation: BAB14888.1 Different initiation.
AK092304 mRNA Translation: BAC03857.1 Sequence problems.
AK299676 mRNA Translation: BAG61585.1
AL158834 Genomic DNA No translation available.
AL391839 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85972.1
CH471072 Genomic DNA Translation: EAW85973.1
BC036529 mRNA Translation: AAH36529.1
CCDSiCCDS60511.1 [Q9H2F5-2]
CCDS7172.1 [Q9H2F5-1]
CCDS73083.1 [Q9H2F5-3]
RefSeqiNP_001258933.1, NM_001272004.1 [Q9H2F5-2]
NP_001258948.1, NM_001272019.2
NP_001269320.1, NM_001282391.1 [Q9H2F5-3]
NP_079485.1, NM_025209.3 [Q9H2F5-1]
UniGeneiHs.167805

Genome annotation databases

EnsembliENST00000263062; ENSP00000263062; ENSG00000120616 [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616 [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616 [Q9H2F5-3]
GeneIDi80314
KEGGihsa:80314
UCSCiuc001iwg.3 human [Q9H2F5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277374 mRNA Translation: AAG41402.1
AF286905 mRNA Translation: AAK60501.1
AK024329 mRNA Translation: BAB14888.1 Different initiation.
AK092304 mRNA Translation: BAC03857.1 Sequence problems.
AK299676 mRNA Translation: BAG61585.1
AL158834 Genomic DNA No translation available.
AL391839 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85972.1
CH471072 Genomic DNA Translation: EAW85973.1
BC036529 mRNA Translation: AAH36529.1
CCDSiCCDS60511.1 [Q9H2F5-2]
CCDS7172.1 [Q9H2F5-1]
CCDS73083.1 [Q9H2F5-3]
RefSeqiNP_001258933.1, NM_001272004.1 [Q9H2F5-2]
NP_001258948.1, NM_001272019.2
NP_001269320.1, NM_001282391.1 [Q9H2F5-3]
NP_079485.1, NM_025209.3 [Q9H2F5-1]
UniGeneiHs.167805

3D structure databases

ProteinModelPortaliQ9H2F5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123227, 39 interactors
ComplexPortaliCPX-709 Piccolo NuA4 histone acetyltransferase complex
CPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H2F5
IntActiQ9H2F5, 16 interactors
MINTiQ9H2F5
STRINGi9606.ENSP00000263062

PTM databases

iPTMnetiQ9H2F5
PhosphoSitePlusiQ9H2F5
SwissPalmiQ9H2F5

Polymorphism and mutation databases

DMDMi59797889

Proteomic databases

EPDiQ9H2F5
MaxQBiQ9H2F5
PaxDbiQ9H2F5
PeptideAtlasiQ9H2F5
PRIDEiQ9H2F5
ProteomicsDBi80540
80541 [Q9H2F5-2]
80542 [Q9H2F5-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263062; ENSP00000263062; ENSG00000120616 [Q9H2F5-1]
ENST00000319778; ENSP00000318559; ENSG00000120616 [Q9H2F5-2]
ENST00000375110; ENSP00000364251; ENSG00000120616 [Q9H2F5-3]
GeneIDi80314
KEGGihsa:80314
UCSCiuc001iwg.3 human [Q9H2F5-1]

Organism-specific databases

CTDi80314
DisGeNETi80314
EuPathDBiHostDB:ENSG00000120616.15
GeneCardsiEPC1
HGNCiHGNC:19876 EPC1
MIMi610999 gene
neXtProtiNX_Q9H2F5
OpenTargetsiENSG00000120616
PharmGKBiPA134981141
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2261 Eukaryota
ENOG410XSSX LUCA
GeneTreeiENSGT00390000013262
HOVERGENiHBG051489
InParanoidiQ9H2F5
KOiK11322
OMAiDYDSMFR
OrthoDBiEOG091G0252
PhylomeDBiQ9H2F5
TreeFamiTF106438

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

ChiTaRSiEPC1 human
GeneWikiiEPC1
GenomeRNAii80314
PROiPR:Q9H2F5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120616 Expressed in 207 organ(s), highest expression level in secondary oocyte
GenevisibleiQ9H2F5 HS

Family and domain databases

InterProiView protein in InterPro
IPR024943 Enhancer_polycomb
IPR019542 Enhancer_polycomb-like_N
IPR009607 Enhancer_polycomb_C
PANTHERiPTHR14898 PTHR14898, 1 hit
PfamiView protein in Pfam
PF06752 E_Pc_C, 1 hit
PF10513 EPL1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiEPC1_HUMAN
AccessioniPrimary (citable) accession number: Q9H2F5
Secondary accession number(s): B4DSC3
, D3DRX7, Q5VW54, Q5VW56, Q5VW58, Q8NAQ4, Q8NE21, Q96LF4, Q96RR6, Q9H7T7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again