Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q9H2B4 (S26A1_HUMAN)

Entry version 165 (29 Sep 2021)
Sequence version 2 (14 Oct 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Sulfate anion transporter 1

Gene

SLC26A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates sulfate transport with high affinity (PubMed:12713736).

Mediates oxalate transport (PubMed:12713736).

Mediates bicarbonate transport (By similarity).

Does not accept succinate as cosubstrate (By similarity).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel
Biological processAnion exchange, Antiport, Ion transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9H2B4

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-174362, Transport and synthesis of PAPS
R-HSA-427601, Multifunctional anion exchangers

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.53.2.16, the sulfate permease (sulp) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sulfate anion transporter 1
Short name:
SAT-1
Alternative name(s):
Solute carrier family 26 member 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC26A1
Synonyms:SAT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10993, SLC26A1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610130, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9H2B4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000145217

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei68 – 90HelicalSequence analysisAdd BLAST23
Transmembranei94 – 116HelicalSequence analysisAdd BLAST23
Transmembranei176 – 198HelicalSequence analysisAdd BLAST23
Transmembranei255 – 277HelicalSequence analysisAdd BLAST23
Transmembranei290 – 309HelicalSequence analysisAdd BLAST20
Transmembranei342 – 364HelicalSequence analysisAdd BLAST23
Transmembranei377 – 399HelicalSequence analysisAdd BLAST23
Transmembranei412 – 434HelicalSequence analysisAdd BLAST23
Transmembranei472 – 494HelicalSequence analysisAdd BLAST23

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Nephrolithiasis, calcium oxalate (CAON)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of nephrolithiasis, a condition in which urinary supersaturation leads to stone formation in the urinary system. Patients manifest acute renal colic with severe pain originating in the flank. Patients with small, non-obstructing stones or those with staghorn calculi may be asymptomatic. The majority of renal calculi contain calcium. CAON is characterized by calcium oxalate kidney stones.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07713456A → T in CAON; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs142573758EnsemblClinVar.1
Natural variantiVAR_077135185T → M in CAON. 1 PublicationCorresponds to variant dbSNP:rs139024319EnsemblClinVar.1
Natural variantiVAR_077136358S → L in CAON. 1 PublicationCorresponds to variant dbSNP:rs148832260EnsemblClinVar.1

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		10861

MalaCards human disease database

More...MalaCardsi		SLC26A1
MIMi167030, phenotype

Open Targets

More...OpenTargetsi		ENSG00000145217

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA400

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9H2B4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC26A1

Domain mapping of disease mutations (DMDM)

More...DMDMi		209572674

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000801551 – 701Sulfate anion transporter 1Add BLAST701

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi158N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi163N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9H2B4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9H2B4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9H2B4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9H2B4

PeptideAtlas

More...PeptideAtlasi		Q9H2B4

PRoteomics IDEntifications database

More...PRIDEi		Q9H2B4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		80523 [Q9H2B4-1]
80524 [Q9H2B4-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9H2B4, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9H2B4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9H2B4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed most abundantly in the kidney and liver, with lower levels in the pancreas, testis, brain, small intestine, colon, and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000145217, Expressed in fundus of stomach and 115 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9H2B4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000145217, Tissue enhanced (kidney, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116071, 3 interactors

Protein interaction database and analysis system

More...IntActi		Q9H2B4, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000354721

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9H2B4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini527 – 687STASPROSITE-ProRule annotationAdd BLAST161

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 20DisorderedSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SLC26A/SulP transporter (TC 2.A.53) family. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0236, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01030000234512

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1234655_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9H2B4

Identification of Orthologs from Complete Genome Data

More...OMAi		EMFARNH

Database of Orthologous Groups

More...OrthoDBi		690428at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9H2B4

TreeFam database of animal gene trees

More...TreeFami		TF313784

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018045, S04_transporter_CS
IPR011547, SLC26A/SulP_dom
IPR001902, SLC26A/SulP_fam
IPR030331, SLC26A1
IPR002645, STAS_dom
IPR036513, STAS_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR11814, PTHR11814, 1 hit
PTHR11814:SF31, PTHR11814:SF31, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01740, STAS, 1 hit
PF00916, Sulfate_transp, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52091, SSF52091, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00815, sulP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01130, SLC26A, 1 hit
PS50801, STAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9H2B4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDESPEPLQQ GRGPVPVRRQ RPAPRGLREM LKARLWCSCS CSVLCVRALV 
        60         70         80         90        100
QDLLPATRWL RQYRPREYLA GDVMSGLVIG IILVPQAIAY SLLAGLQPIY 
       110        120        130        140        150
SLYTSFFANL IYFLMGTSRH VSVGIFSLLC LMVGQVVDRE LQLAGFDPSQ 
       160        170        180        190        200
DGLQPGANSS TLNGSAAMLD CGRDCYAIRV ATALTLMTGL YQVLMGVLRL 
       210        220        230        240        250
GFVSAYLSQP LLDGFAMGAS VTILTSQLKH LLGVRIPRHQ GPGMVVLTWL 
       260        270        280        290        300
SLLRGAGQAN VCDVVTSTVC LAVLLAAKEL SDRYRHRLRV PLPTELLVIV 
       310        320        330        340        350
VATLVSHFGQ LHKRFGSSVA GDIPTGFMPP QVPEPRLMQR VALDAVALAL 
       360        370        380        390        400
VAAAFSISLA EMFARSHGYS VRANQELLAV GCCNVLPAFL HCFATSAALA 
       410        420        430        440        450
KSLVKTATGC RTQLSSVVSA TVVLLVLLAL APLFHDLQRS VLACVIVVSL 
       460        470        480        490        500
RGALRKVWDL PRLWRMSPAD ALVWAGTAAT CMLVSTEAGL LAGVILSLLS 
       510        520        530        540        550
LAGRTQRPRT ALLARIGDTA FYEDATEFEG LVPEPGVRVF RFGGPLYYAN 
       560        570        580        590        600
KDFFLQSLYS LTGLDAGCMA ARRKEGGSET GVGEGGPAQG EDLGPVSTRA 
       610        620        630        640        650
ALVPAAAGFH TVVIDCAPLL FLDAAGVSTL QDLRRDYGAL GISLLLACCS 
       660        670        680        690        700
PPVRDILSRG GFLGEGPGDT AEEEQLFLSV HDAVQTARAR HRELEATDAH 

L
Length:701
Mass (Da):75,016
Last modified:October 14, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA37E9E3D232043AD
GO
Isoform 2 (identifier: Q9H2B4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-224: VLMGVLRLGFVSAYLSQPLLDGFAMGASVTIL → TSWGRNSFQQHPWQLTQRSDSQELLEEEERSC
     225-701: Missing.

Show »
Length:224
Mass (Da):24,962
Checksum:iC7E7FE5F7ED0E946
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti459 – 460DL → GF in AAG22075 (PubMed:11087667).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07713456A → T in CAON; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs142573758EnsemblClinVar.1
Natural variantiVAR_077135185T → M in CAON. 1 PublicationCorresponds to variant dbSNP:rs139024319EnsemblClinVar.1
Natural variantiVAR_077136358S → L in CAON. 1 PublicationCorresponds to variant dbSNP:rs148832260EnsemblClinVar.1
Natural variantiVAR_046727556Q → R2 PublicationsCorresponds to variant dbSNP:rs3796622Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043671193 – 224VLMGV…SVTIL → TSWGRNSFQQHPWQLTQRSD SQELLEEEERSC in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_043672225 – 701Missing in isoform 2. 1 PublicationAdd BLAST477

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF297659 mRNA Translation: AAG22075.1
AY124771 mRNA Translation: AAM94171.1
AK292747 mRNA Translation: BAF85436.1
AC019103 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82628.1
CH471131 Genomic DNA Translation: EAW82629.1
BC015517 mRNA Translation: AAH15517.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33933.1 [Q9H2B4-2]
CCDS33934.1 [Q9H2B4-1]

NCBI Reference Sequences

More...RefSeqi		NP_071325.2, NM_022042.3 [Q9H2B4-1]
NP_602297.1, NM_134425.2 [Q9H2B4-2]
NP_998778.1, NM_213613.3 [Q9H2B4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000361661; ENSP00000354721; ENSG00000145217 [Q9H2B4-1]
ENST00000398516; ENSP00000381528; ENSG00000145217 [Q9H2B4-1]
ENST00000398520; ENSP00000381532; ENSG00000145217 [Q9H2B4-2]
ENST00000622731; ENSP00000483506; ENSG00000145217 [Q9H2B4-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10861

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10861

UCSC genome browser

More...UCSCi		uc003gbx.5, human [Q9H2B4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297659 mRNA Translation: AAG22075.1
AY124771 mRNA Translation: AAM94171.1
AK292747 mRNA Translation: BAF85436.1
AC019103 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82628.1
CH471131 Genomic DNA Translation: EAW82629.1
BC015517 mRNA Translation: AAH15517.1
CCDSiCCDS33933.1 [Q9H2B4-2]
CCDS33934.1 [Q9H2B4-1]
RefSeqiNP_071325.2, NM_022042.3 [Q9H2B4-1]
NP_602297.1, NM_134425.2 [Q9H2B4-2]
NP_998778.1, NM_213613.3 [Q9H2B4-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi116071, 3 interactors
IntActiQ9H2B4, 2 interactors
STRINGi9606.ENSP00000354721

Protein family/group databases

TCDBi2.A.53.2.16, the sulfate permease (sulp) family

PTM databases

GlyGeniQ9H2B4, 2 sites
iPTMnetiQ9H2B4
PhosphoSitePlusiQ9H2B4

Genetic variation databases

BioMutaiSLC26A1
DMDMi209572674

Proteomic databases

jPOSTiQ9H2B4
MassIVEiQ9H2B4
MaxQBiQ9H2B4
PaxDbiQ9H2B4
PeptideAtlasiQ9H2B4
PRIDEiQ9H2B4
ProteomicsDBi80523 [Q9H2B4-1]
80524 [Q9H2B4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		8230, 105 antibodies

The CPTC Antibody Portal

More...CPTCi		Q9H2B4, 3 antibodies

The DNASU plasmid repository

More...DNASUi		10861

Genome annotation databases

EnsembliENST00000361661; ENSP00000354721; ENSG00000145217 [Q9H2B4-1]
ENST00000398516; ENSP00000381528; ENSG00000145217 [Q9H2B4-1]
ENST00000398520; ENSP00000381532; ENSG00000145217 [Q9H2B4-2]
ENST00000622731; ENSP00000483506; ENSG00000145217 [Q9H2B4-2]
GeneIDi10861
KEGGihsa:10861
UCSCiuc003gbx.5, human [Q9H2B4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10861
DisGeNETi10861

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC26A1
HGNCiHGNC:10993, SLC26A1
HPAiENSG00000145217, Tissue enhanced (kidney, liver)
MalaCardsiSLC26A1
MIMi167030, phenotype
610130, gene
neXtProtiNX_Q9H2B4
OpenTargetsiENSG00000145217
PharmGKBiPA400
VEuPathDBiHostDB:ENSG00000145217

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0236, Eukaryota
GeneTreeiENSGT01030000234512
HOGENOMiCLU_1234655_0_0_1
InParanoidiQ9H2B4
OMAiEMFARNH
OrthoDBi690428at2759
PhylomeDBiQ9H2B4
TreeFamiTF313784

Enzyme and pathway databases

PathwayCommonsiQ9H2B4
ReactomeiR-HSA-174362, Transport and synthesis of PAPS
R-HSA-427601, Multifunctional anion exchangers

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10861, 5 hits in 1019 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC26A1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10861
PharosiQ9H2B4, Tbio

Protein Ontology

More...PROi		PR:Q9H2B4
RNActiQ9H2B4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000145217, Expressed in fundus of stomach and 115 other tissues
GenevisibleiQ9H2B4, HS

Family and domain databases

InterProiView protein in InterPro
IPR018045, S04_transporter_CS
IPR011547, SLC26A/SulP_dom
IPR001902, SLC26A/SulP_fam
IPR030331, SLC26A1
IPR002645, STAS_dom
IPR036513, STAS_dom_sf
PANTHERiPTHR11814, PTHR11814, 1 hit
PTHR11814:SF31, PTHR11814:SF31, 1 hit
PfamiView protein in Pfam
PF01740, STAS, 1 hit
PF00916, Sulfate_transp, 1 hit
SUPFAMiSSF52091, SSF52091, 1 hit
TIGRFAMsiTIGR00815, sulP, 1 hit
PROSITEiView protein in PROSITE
PS01130, SLC26A, 1 hit
PS50801, STAS, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS26A1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H2B4
Secondary accession number(s): A8K9N2, Q7Z5R3, Q96BK0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 5, 2002
Last sequence update: October 14, 2008
Last modified: September 29, 2021
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again