Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (02 Jun 2021)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Potassium voltage-gated channel subfamily H member 6

Gene

KCNH6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, rectifying current (By similarity).

Channel properties may be modulated by cAMP and subunit assembly.

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi594 – 711cNMPAdd BLAST118

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandPotassium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9H252

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1296072, Voltage gated Potassium channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Potassium voltage-gated channel subfamily H member 6
Alternative name(s):
Ether-a-go-go-related gene potassium channel 2
Short name:
ERG-2
Short name:
Eag-related protein 2
Short name:
Ether-a-go-go-related protein 2
Short name:
hERG-2
Short name:
hERG2
Voltage-gated potassium channel subunit Kv11.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNH6
Synonyms:ERG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18862, KCNH6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608168, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H252

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000173826.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 261CytoplasmicSequence analysisAdd BLAST261
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei262 – 282Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini283 – 298ExtracellularSequence analysisAdd BLAST16
Transmembranei299 – 319Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini320 – 340CytoplasmicSequence analysisAdd BLAST21
Transmembranei341 – 361Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini362 – 370ExtracellularSequence analysis9
Transmembranei371 – 391Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini392 – 398CytoplasmicSequence analysis7
Transmembranei399 – 419Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini420 – 463ExtracellularSequence analysisAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei464 – 484Pore-forming; Name=Segment H5Sequence analysisAdd BLAST21
Topological domaini485 – 490ExtracellularSequence analysis6
Transmembranei491 – 511Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini512 – 994CytoplasmicSequence analysisAdd BLAST483

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
81033

Open Targets

More...
OpenTargetsi
ENSG00000173826

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38722

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H252, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2362996

Drug and drug target database

More...
DrugBanki
DB01118, Amiodarone
DB00321, Amitriptyline
DB00590, Doxazosin
DB00228, Enflurane
DB00308, Ibutilide
DB01110, Miconazole
DB01069, Promethazine
DB01162, Terazosin

DrugCentral

More...
DrugCentrali
Q9H252

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
573

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KCNH6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
26006810

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000540131 – 994Potassium voltage-gated channel subfamily H member 6Add BLAST994

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi449N-linked (GlcNAc...) (complex) asparagine1 Publication1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H252

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H252

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H252

PeptideAtlas

More...
PeptideAtlasi
Q9H252

PRoteomics IDEntifications database

More...
PRIDEi
Q9H252

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80495 [Q9H252-1]
80496 [Q9H252-2]
80497 [Q9H252-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9H252, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H252

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H252

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in prolactin-secreting adenomas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173826, Expressed in dorsal plus ventral thalamus and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H252, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H252, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000173826, Tissue enhanced (intestine, kidney, pituitary gland, retina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming alpha subunits that can associate with modulating beta subunits. Heteromultimers with KCNH2/ERG1 and KCNH7/ERG3 (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000463533

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H252, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H252

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini41 – 70PASAdd BLAST30
Domaini92 – 144PACAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni720 – 790DisorderedSequence analysisAdd BLAST71
Regioni880 – 946DisorderedSequence analysisAdd BLAST67

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi476 – 481Selectivity filterBy similarity6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi725 – 750Polar residuesSequence analysisAdd BLAST26

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0498, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157790

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005746_2_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H252

Identification of Orthologs from Complete Genome Data

More...
OMAi
HSPPNPQ

Database of Orthologous Groups

More...
OrthoDBi
247304at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H252

TreeFam database of animal gene trees

More...
TreeFami
TF313130

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00038, CAP_ED, 1 hit
cd00130, PAS, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 1 hit
2.60.120.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018490, cNMP-bd-like
IPR000595, cNMP-bd_dom
IPR005821, Ion_trans_dom
IPR003938, K_chnl_volt-dep_EAG/ELK/ERG
IPR003967, K_chnl_volt-dep_ERG
IPR030172, KCNH6
IPR000014, PAS
IPR035965, PAS-like_dom_sf
IPR014710, RmlC-like_jellyroll
IPR027359, Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10217:SF468, PTHR10217:SF468, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00027, cNMP_binding, 1 hit
PF00520, Ion_trans, 1 hit
PF13426, PAS_9, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01463, EAGCHANLFMLY
PR01470, ERGCHANNEL

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00100, cNMP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51206, SSF51206, 1 hit
SSF55785, SSF55785, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50042, CNMP_BINDING_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H252-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVRRGHVAP QNTYLDTIIR KFEGQSRKFL IANAQMENCA IIYCNDGFCE
60 70 80 90 100
LFGYSRVEVM QQPCTCDFLT GPNTPSSAVS RLAQALLGAE ECKVDILYYR
110 120 130 140 150
KDASSFRCLV DVVPVKNEDG AVIMFILNFE DLAQLLAKCS SRSLSQRLLS
160 170 180 190 200
QSFLGSEGSH GRPGGPGPGT GRGKYRTISQ IPQFTLNFVE FNLEKHRSSS
210 220 230 240 250
TTEIEIIAPH KVVERTQNVT EKVTQVLSLG ADVLPEYKLQ APRIHRWTIL
260 270 280 290 300
HYSPFKAVWD WLILLLVIYT AVFTPYSAAF LLSDQDESRR GACSYTCSPL
310 320 330 340 350
TVVDLIVDIM FVVDIVINFR TTYVNTNDEV VSHPRRIAVH YFKGWFLIDM
360 370 380 390 400
VAAIPFDLLI FRTGSDETTT LIGLLKTARL LRLVRVARKL DRYSEYGAAV
410 420 430 440 450
LFLLMCTFAL IAHWLACIWY AIGNVERPYL EHKIGWLDSL GVQLGKRYNG
460 470 480 490 500
SDPASGPSVQ DKYVTALYFT FSSLTSVGFG NVSPNTNSEK VFSICVMLIG
510 520 530 540 550
SLMYASIFGN VSAIIQRLYS GTARYHTQML RVKEFIRFHQ IPNPLRQRLE
560 570 580 590 600
EYFQHAWSYT NGIDMNAVLK GFPECLQADI CLHLHRALLQ HCPAFSGAGK
610 620 630 640 650
GCLRALAVKF KTTHAPPGDT LVHLGDVLST LYFISRGSIE ILRDDVVVAI
660 670 680 690 700
LGKNDIFGEP VSLHAQPGKS SADVRALTYC DLHKIQRADL LEVLDMYPAF
710 720 730 740 750
AESFWSKLEV TFNLRDAAGG LHSSPRQAPG SQDHQGFFLS DNQSGSPHEL
760 770 780 790 800
GPQFPSKGYS LLGPGSQNSM GAGPCAPGHP DAAPPLSISD ASGLWPELLQ
810 820 830 840 850
EMPPRHSPQS PQEDPDCWPL KLGSRLEQLQ AQMNRLESRV SSDLSRILQL
860 870 880 890 900
LQKPMPQGHA SYILEAPASN DLALVPIASE TTSPGPRLPQ GFLPPAQTPS
910 920 930 940 950
YGDLDDCSPK HRNSSPRMPH LAVATDKTLA PSSEQEQPEG LWPPLASPLH
960 970 980 990
PLEVQGLICG PCFSSLPEHL GSVPKQLDFQ RHGSDPGFAG SWGH
Length:994
Mass (Da):109,925
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBE9ECB349A798576
GO
Isoform 2 (identifier: Q9H252-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-472: WYAIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFS → C
     745-780: Missing.

Show »
Length:905
Mass (Da):100,450
Checksum:i0556E274946D2B7E
GO
Isoform 3 (identifier: Q9H252-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     501-502: SL → CE
     503-994: Missing.

Show »
Length:502
Mass (Da):56,298
Checksum:i6CBD9F336841809B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J9JID4J9JID4_HUMAN
Potassium voltage-gated channel sub...
KCNH6
958Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSC2J3KSC2_HUMAN
Potassium voltage-gated channel sub...
KCNH6
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti963F → L in BAC03764 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053857165G → R. Corresponds to variant dbSNP:rs35399062Ensembl.1
Natural variantiVAR_053858925T → M1 PublicationCorresponds to variant dbSNP:rs35819807Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000977419 – 472WYAIG…YFTFS → C in isoform 2. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_000979501 – 502SL → CE in isoform 3. 1 Publication2
Alternative sequenceiVSP_000980503 – 994Missing in isoform 3. 1 PublicationAdd BLAST492
Alternative sequenceiVSP_000978745 – 780Missing in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF311913 mRNA Translation: AAG40871.1
AK090969 mRNA Translation: BAC03559.1
AK091877 mRNA Translation: BAC03764.1
BC006334 mRNA Translation: AAH06334.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11638.1 [Q9H252-1]
CCDS11639.1 [Q9H252-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001265848.1, NM_001278919.1
NP_001265849.1, NM_001278920.1
NP_110406.1, NM_030779.3 [Q9H252-1]
NP_775115.1, NM_173092.2 [Q9H252-2]
XP_011523612.1, XM_011525310.2 [Q9H252-2]
XP_016880664.1, XM_017025175.1 [Q9H252-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000456941; ENSP00000396900; ENSG00000173826 [Q9H252-2]
ENST00000580652; ENSP00000464672; ENSG00000173826 [Q9H252-3]
ENST00000581784; ENSP00000463830; ENSG00000173826 [Q9H252-2]
ENST00000583023; ENSP00000463533; ENSG00000173826 [Q9H252-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
81033

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:81033

UCSC genome browser

More...
UCSCi
uc002jax.2, human [Q9H252-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF311913 mRNA Translation: AAG40871.1
AK090969 mRNA Translation: BAC03559.1
AK091877 mRNA Translation: BAC03764.1
BC006334 mRNA Translation: AAH06334.1
CCDSiCCDS11638.1 [Q9H252-1]
CCDS11639.1 [Q9H252-2]
RefSeqiNP_001265848.1, NM_001278919.1
NP_001265849.1, NM_001278920.1
NP_110406.1, NM_030779.3 [Q9H252-1]
NP_775115.1, NM_173092.2 [Q9H252-2]
XP_011523612.1, XM_011525310.2 [Q9H252-2]
XP_016880664.1, XM_017025175.1 [Q9H252-1]

3D structure databases

SMRiQ9H252
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000463533

Chemistry databases

ChEMBLiCHEMBL2362996
DrugBankiDB01118, Amiodarone
DB00321, Amitriptyline
DB00590, Doxazosin
DB00228, Enflurane
DB00308, Ibutilide
DB01110, Miconazole
DB01069, Promethazine
DB01162, Terazosin
DrugCentraliQ9H252
GuidetoPHARMACOLOGYi573

PTM databases

GlyGeniQ9H252, 1 site
iPTMnetiQ9H252
PhosphoSitePlusiQ9H252

Genetic variation databases

BioMutaiKCNH6
DMDMi26006810

Proteomic databases

jPOSTiQ9H252
MassIVEiQ9H252
PaxDbiQ9H252
PeptideAtlasiQ9H252
PRIDEiQ9H252
ProteomicsDBi80495 [Q9H252-1]
80496 [Q9H252-2]
80497 [Q9H252-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
18667, 136 antibodies

The DNASU plasmid repository

More...
DNASUi
81033

Genome annotation databases

EnsembliENST00000456941; ENSP00000396900; ENSG00000173826 [Q9H252-2]
ENST00000580652; ENSP00000464672; ENSG00000173826 [Q9H252-3]
ENST00000581784; ENSP00000463830; ENSG00000173826 [Q9H252-2]
ENST00000583023; ENSP00000463533; ENSG00000173826 [Q9H252-1]
GeneIDi81033
KEGGihsa:81033
UCSCiuc002jax.2, human [Q9H252-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81033
DisGeNETi81033

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KCNH6
HGNCiHGNC:18862, KCNH6
HPAiENSG00000173826, Tissue enhanced (intestine, kidney, pituitary gland, retina)
MIMi608168, gene
neXtProtiNX_Q9H252
OpenTargetsiENSG00000173826
PharmGKBiPA38722
VEuPathDBiHostDB:ENSG00000173826.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0498, Eukaryota
GeneTreeiENSGT00940000157790
HOGENOMiCLU_005746_2_3_1
InParanoidiQ9H252
OMAiHSPPNPQ
OrthoDBi247304at2759
PhylomeDBiQ9H252
TreeFamiTF313130

Enzyme and pathway databases

PathwayCommonsiQ9H252
ReactomeiR-HSA-1296072, Voltage gated Potassium channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
81033, 0 hits in 982 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KCNH6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
81033
PharosiQ9H252, Tclin

Protein Ontology

More...
PROi
PR:Q9H252
RNActiQ9H252, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173826, Expressed in dorsal plus ventral thalamus and 129 other tissues
ExpressionAtlasiQ9H252, baseline and differential
GenevisibleiQ9H252, HS

Family and domain databases

CDDicd00038, CAP_ED, 1 hit
cd00130, PAS, 1 hit
Gene3Di1.20.120.350, 1 hit
2.60.120.10, 1 hit
InterProiView protein in InterPro
IPR018490, cNMP-bd-like
IPR000595, cNMP-bd_dom
IPR005821, Ion_trans_dom
IPR003938, K_chnl_volt-dep_EAG/ELK/ERG
IPR003967, K_chnl_volt-dep_ERG
IPR030172, KCNH6
IPR000014, PAS
IPR035965, PAS-like_dom_sf
IPR014710, RmlC-like_jellyroll
IPR027359, Volt_channel_dom_sf
PANTHERiPTHR10217:SF468, PTHR10217:SF468, 1 hit
PfamiView protein in Pfam
PF00027, cNMP_binding, 1 hit
PF00520, Ion_trans, 1 hit
PF13426, PAS_9, 1 hit
PRINTSiPR01463, EAGCHANLFMLY
PR01470, ERGCHANNEL
SMARTiView protein in SMART
SM00100, cNMP, 1 hit
SUPFAMiSSF51206, SSF51206, 1 hit
SSF55785, SSF55785, 1 hit
PROSITEiView protein in PROSITE
PS50042, CNMP_BINDING_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNH6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H252
Secondary accession number(s): Q9BRD7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: March 1, 2001
Last modified: June 2, 2021
This is version 182 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again