Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (08 May 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

VIP36-like protein

Gene

LMAN2L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei93CarbohydratePROSITE-ProRule annotation1
Binding sitei128CarbohydratePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi159CalciumPROSITE-ProRule annotation1
Metal bindingi161CalciumPROSITE-ProRule annotation1
Metal bindingi163CalciumPROSITE-ProRule annotation1
Binding sitei188CarbohydratePROSITE-ProRule annotation1
Metal bindingi191CalciumPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • mannose binding Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLectin, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-204005 COPII-mediated vesicle transport
R-HSA-5694530 Cargo concentration in the ER

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
VIP36-like protein
Alternative name(s):
Lectin mannose-binding 2-like
Short name:
LMAN2-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMAN2L
Synonyms:VIPL
ORF Names:PSEC0028, UNQ368/PRO704
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19263 LMAN2L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609552 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H0V9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini45 – 313LumenalSequence analysisAdd BLAST269
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei314 – 336HelicalSequence analysisAdd BLAST23
Topological domaini337 – 348CytoplasmicSequence analysisAdd BLAST12

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, autosomal recessive 52 (MRT52)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRT52 clinical features include global developmental delay, severe intellectual disability with poor speech, and mild seizures in early childhood.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07642953R → Q in MRT52; no effect on general protein glycosylation. 1 PublicationCorresponds to variant dbSNP:rs869320632EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi344 – 346RKR → SSS: Loss of ER retention. 1 Publication3

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
81562

MalaCards human disease database

More...
MalaCardsi
LMAN2L
MIMi616887 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000114988

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
88616 Autosomal recessive non-syndromic intellectual disability

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134937652

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMAN2L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29611906

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 44Sequence analysisAdd BLAST44
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001766845 – 348VIP36-like proteinAdd BLAST304

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi181N-linked (GlcNAc...) (high mannose) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi200 ↔ 237PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H0V9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H0V9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H0V9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H0V9

PeptideAtlas

More...
PeptideAtlasi
Q9H0V9

PRoteomics IDEntifications database

More...
PRIDEi
Q9H0V9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
80329
80330 [Q9H0V9-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9H0V9-1 [Q9H0V9-1]
Q9H0V9-2 [Q9H0V9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H0V9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H0V9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9H0V9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in numerous tissues. Highest expression in skeletal muscle and kidney, intermediate levels in heart, liver and placenta, low levels in brain, thymus, spleen, small intestine and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000114988 Expressed in 215 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H0V9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H0V9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026600

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123525, 51 interactors

Protein interaction database and analysis system

More...
IntActi
Q9H0V9, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000366280

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H0V9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini49 – 274L-type lectin-likePROSITE-ProRule annotationAdd BLAST226

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni161 – 163Carbohydrate bindingPROSITE-ProRule annotation3
Regioni258 – 260Carbohydrate bindingPROSITE-ProRule annotation3

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi344 – 346Endoplasmic reticulum retention signal3

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3839 Eukaryota
ENOG410YH8V LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155596

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000164540

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H0V9

KEGG Orthology (KO)

More...
KOi
K10083

Identification of Orthologs from Complete Genome Data

More...
OMAi
RVPCYLR

Database of Orthologous Groups

More...
OrthoDBi
1377709at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H0V9

TreeFam database of animal gene trees

More...
TreeFami
TF313311

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR005052 Lectin_leg

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03388 Lectin_leg-like, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51328 L_LECTIN_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0V9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATLGPLGS WQQWRRCLSA RDGSRMLLLL LLLGSGQGPQ QVGAGQTFEY
60 70 80 90 100
LKREHSLSKP YQGVGTGSSS LWNLMGNAMV MTQYIRLTPD MQSKQGALWN
110 120 130 140 150
RVPCFLRDWE LQVHFKIHGQ GKKNLHGDGL AIWYTKDRMQ PGPVFGNMDK
160 170 180 190 200
FVGLGVFVDT YPNEEKQQER VFPYISAMVN NGSLSYDHER DGRPTELGGC
210 220 230 240 250
TAIVRNLHYD TFLVIRYVKR HLTIMMDIDG KHEWRDCIEV PGVRLPRGYY
260 270 280 290 300
FGTSSITGDL SDNHDVISLK LFELTVERTP EEEKLHRDVF LPSVDNMKLP
310 320 330 340
EMTAPLPPLS GLALFLIVFF SLVFSVFAIV IGIILYNKWQ EQSRKRFY
Length:348
Mass (Da):39,711
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF79382E20AE67751
GO
Isoform 2 (identifier: Q9H0V9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: E → EAQKRRYSPGVQ

Show »
Length:359
Mass (Da):40,982
Checksum:iAD6D7005E85787B1
GO
Isoform 3 (identifier: Q9H0V9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGS → MDKERRICMGMAWQSGTQRIGCSQAQKRRYSPGVQ
     36-169: Missing.

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):24,712
Checksum:iCBAA3745F78E3D39
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WB07F8WB07_HUMAN
VIP36-like protein
LMAN2L
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEK5F8WEK5_HUMAN
VIP36-like protein
LMAN2L
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2L5F2Z2L5_HUMAN
VIP36-like protein
LMAN2L
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCX4F8WCX4_HUMAN
VIP36-like protein
LMAN2L
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4T → A in BAC11559 (PubMed:16303743).Curated1
Sequence conflicti69S → P in BAD96548 (Ref. 5) Curated1
Sequence conflicti288D → G in BAC11559 (PubMed:16303743).Curated1
Sequence conflicti345K → R in BAD96548 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07642953R → Q in MRT52; no effect on general protein glycosylation. 1 PublicationCorresponds to variant dbSNP:rs869320632EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0544391 – 35MAATL…LLLGS → MDKERRICMGMAWQSGTQRI GCSQAQKRRYSPGVQ in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_05444036 – 169Missing in isoform 3. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_017940169E → EAQKRRYSPGVQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ549957 mRNA Translation: CAD71268.1
AL136617 mRNA Translation: CAB66552.1
AY358929 mRNA Translation: AAQ89288.1
AK299740 mRNA Translation: BAG61635.1
AK222828 mRNA Translation: BAD96548.1
AK075347 mRNA Translation: BAC11559.1
BX648002 mRNA Translation: CAH56196.1
AC068539 Genomic DNA Translation: AAX93211.1
CH471207 Genomic DNA Translation: EAW71341.1
CH471207 Genomic DNA Translation: EAW71343.1
BC000347 mRNA Translation: AAH00347.2
BC005822 mRNA Translation: AAH05822.2
BC005862 mRNA Translation: AAH05862.2
BC067265 mRNA Translation: AAH67265.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2023.1 [Q9H0V9-1]
CCDS46365.1 [Q9H0V9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001135764.1, NM_001142292.1 [Q9H0V9-2]
NP_001309275.1, NM_001322346.1 [Q9H0V9-3]
NP_001309276.1, NM_001322347.1
NP_001309279.1, NM_001322350.1
NP_001309280.1, NM_001322351.1
NP_001309283.1, NM_001322354.1 [Q9H0V9-3]
NP_110432.1, NM_030805.3 [Q9H0V9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000264963; ENSP00000264963; ENSG00000114988 [Q9H0V9-1]
ENST00000377079; ENSP00000366280; ENSG00000114988 [Q9H0V9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
81562

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:81562

UCSC genome browser

More...
UCSCi
uc002swu.4 human [Q9H0V9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ549957 mRNA Translation: CAD71268.1
AL136617 mRNA Translation: CAB66552.1
AY358929 mRNA Translation: AAQ89288.1
AK299740 mRNA Translation: BAG61635.1
AK222828 mRNA Translation: BAD96548.1
AK075347 mRNA Translation: BAC11559.1
BX648002 mRNA Translation: CAH56196.1
AC068539 Genomic DNA Translation: AAX93211.1
CH471207 Genomic DNA Translation: EAW71341.1
CH471207 Genomic DNA Translation: EAW71343.1
BC000347 mRNA Translation: AAH00347.2
BC005822 mRNA Translation: AAH05822.2
BC005862 mRNA Translation: AAH05862.2
BC067265 mRNA Translation: AAH67265.1
CCDSiCCDS2023.1 [Q9H0V9-1]
CCDS46365.1 [Q9H0V9-2]
RefSeqiNP_001135764.1, NM_001142292.1 [Q9H0V9-2]
NP_001309275.1, NM_001322346.1 [Q9H0V9-3]
NP_001309276.1, NM_001322347.1
NP_001309279.1, NM_001322350.1
NP_001309280.1, NM_001322351.1
NP_001309283.1, NM_001322354.1 [Q9H0V9-3]
NP_110432.1, NM_030805.3 [Q9H0V9-1]

3D structure databases

SMRiQ9H0V9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123525, 51 interactors
IntActiQ9H0V9, 4 interactors
STRINGi9606.ENSP00000366280

PTM databases

iPTMnetiQ9H0V9
PhosphoSitePlusiQ9H0V9
SwissPalmiQ9H0V9

Polymorphism and mutation databases

BioMutaiLMAN2L
DMDMi29611906

Proteomic databases

EPDiQ9H0V9
jPOSTiQ9H0V9
MaxQBiQ9H0V9
PaxDbiQ9H0V9
PeptideAtlasiQ9H0V9
PRIDEiQ9H0V9
ProteomicsDBi80329
80330 [Q9H0V9-2]
TopDownProteomicsiQ9H0V9-1 [Q9H0V9-1]
Q9H0V9-2 [Q9H0V9-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
81562
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264963; ENSP00000264963; ENSG00000114988 [Q9H0V9-1]
ENST00000377079; ENSP00000366280; ENSG00000114988 [Q9H0V9-2]
GeneIDi81562
KEGGihsa:81562
UCSCiuc002swu.4 human [Q9H0V9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81562
DisGeNETi81562

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMAN2L
HGNCiHGNC:19263 LMAN2L
HPAiHPA026600
MalaCardsiLMAN2L
MIMi609552 gene
616887 phenotype
neXtProtiNX_Q9H0V9
OpenTargetsiENSG00000114988
Orphaneti88616 Autosomal recessive non-syndromic intellectual disability
PharmGKBiPA134937652

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3839 Eukaryota
ENOG410YH8V LUCA
GeneTreeiENSGT00940000155596
HOGENOMiHOG000164540
InParanoidiQ9H0V9
KOiK10083
OMAiRVPCYLR
OrthoDBi1377709at2759
PhylomeDBiQ9H0V9
TreeFamiTF313311

Enzyme and pathway databases

ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-5694530 Cargo concentration in the ER

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMAN2L human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LMAN2L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
81562

Protein Ontology

More...
PROi
PR:Q9H0V9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000114988 Expressed in 215 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiQ9H0V9 baseline and differential
GenevisibleiQ9H0V9 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR005052 Lectin_leg
PfamiView protein in Pfam
PF03388 Lectin_leg-like, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS51328 L_LECTIN_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMA2L_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H0V9
Secondary accession number(s): B4DSH3
, D3DXH6, Q53GV3, Q53S67, Q63HN6, Q8NBQ6, Q9BQ14
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2003
Last sequence update: March 1, 2001
Last modified: May 8, 2019
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again