Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (18 Sep 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Gamma-aminobutyric acid receptor-associated protein-like 1

Gene

GABARAPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAutophagy

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1632852 Macroautophagy

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9H0R8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gamma-aminobutyric acid receptor-associated protein-like 1
Alternative name(s):
Early estrogen-regulated protein
GABA(A) receptor-associated protein-like 1
Glandular epithelial cell protein 1
Short name:
GEC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GABARAPL1
Synonyms:GEC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4068 GABARAPL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607420 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H0R8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Endoplasmic reticulum, Golgi apparatus, Membrane, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi116G → A: No processing of precursor. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
23710

Open Targets

More...
OpenTargetsi
ENSG00000139112

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28481

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GABARAPL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
44887973

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002123691 – 116Gamma-aminobutyric acid receptor-associated protein-like 1Add BLAST116
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000420208117Removed in mature form1

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi116Phosphatidylethanolamine amidated glycine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor molecule is cleaved by ATG4B to form the cytosolic form, GABARAPL1-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, GABARAPL1-II (By similarity). ATG4B also mediates the delipidation required for GABARAPL1 recycling when autophagosomes fuse with lysosomes (PubMed:20404487).By similarity1 Publication
The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei115 – 116Cleavage; by RavZ2
Sitei116 – 117Cleavage; by ATG4B2

Keywords - PTMi

Lipoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H0R8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H0R8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H0R8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H0R8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H0R8

PeptideAtlas

More...
PeptideAtlasi
Q9H0R8

PRoteomics IDEntifications database

More...
PRIDEi
Q9H0R8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
5710
80321 [Q9H0R8-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H0R8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H0R8

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9H0R8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000139112 Expressed in 241 organ(s), highest expression level in primary visual cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H0R8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H0R8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051386
HPA065883

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GABRG2 and beta-tubulin (By similarity).

Interacts with ATG13, OPRK1, RB1CC1 and ULK1.

Interacts with TP53INP1 and TP53INP2. Directly interacts with SQSTM1.

Interacts with ATG3, ATG7 and MAP15.

Interacts with TECPR2.

Interacts with TBC1D5 (PubMed:22354992).

Interacts with TRIM5 (PubMed:25127057).

Interacts with MEFV and TRIM21 (PubMed:26347139).

Interacts with WDFY3 (PubMed:24668264).

By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117223, 79 interactors

Database of interacting proteins

More...
DIPi
DIP-35597N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9H0R8

Protein interaction database and analysis system

More...
IntActi
Q9H0R8, 535 interactors

Molecular INTeraction database

More...
MINTi
Q9H0R8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000266458

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1117
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H0R8

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9H0R8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 22Interaction with beta-tubulinBy similarityAdd BLAST22
Regioni36 – 68Interaction with GABRG2By similarityAdd BLAST33

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATG8 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1654 Eukaryota
ENOG4111JAT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156876

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070205

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H0R8

KEGG Orthology (KO)

More...
KOi
K08341

Identification of Orthologs from Complete Genome Data

More...
OMAi
VICERAP

Database of Orthologous Groups

More...
OrthoDBi
1508198at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H0R8

TreeFam database of animal gene trees

More...
TreeFami
TF314556

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004241 Atg8-like
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR10969 PTHR10969, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02991 Atg8, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236 SSF54236, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0R8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFQYKEDHP FEYRKKEGEK IRKKYPDRVP VIVEKAPKAR VPDLDKRKYL
60 70 80 90 100
VPSDLTVGQF YFLIRKRIHL RPEDALFFFV NNTIPPTSAT MGQLYEDNHE
110
EDYFLYVAYS DESVYGK
Length:117
Mass (Da):14,044
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7F56E345255F564B
GO
Isoform 2 (identifier: Q9H0R8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-117: DNHEEDYFLYVAYSDESVYGK → VMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL

Show »
Length:146
Mass (Da):17,008
Checksum:iFC0CDEB0EF8F4529
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYD9F5GYD9_HUMAN
Gamma-aminobutyric acid receptor-as...
GABARAPL1
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GZY7F5GZY7_HUMAN
Gamma-aminobutyric acid receptor-as...
GABARAPL1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GX12F5GX12_HUMAN
Gamma-aminobutyric acid receptor-as...
GABARAPL1
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H007F5H007_HUMAN
Gamma-aminobutyric acid receptor-as...
GABARAPL1
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V1T7G3V1T7_HUMAN
GABA(A) receptor-associated protein...
GABARAPL1 hCG_38151
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JKT8A0A0G2JKT8_HUMAN
Gamma-aminobutyric acid receptor-as...
GABARAPL1
10Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04442297 – 117DNHEE…SVYGK → VMVLVAQYWMPSSAVWHPLA LVLDALITHLRSGAEGVIYP DPLTYGSVRL in isoform 2. 2 PublicationsAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF287012 mRNA Translation: AAK55962.1
AF087847 mRNA Translation: AAK20399.1
JN663881 mRNA Translation: AEZ06294.1
AL136676 mRNA Translation: CAB66611.1
AK303581 mRNA Translation: BAG64599.1
CR533480 mRNA Translation: CAG38511.1
AC115676 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96164.1
BC009309 mRNA Translation: AAH09309.1
BC028315 mRNA Translation: AAH28315.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8620.1 [Q9H0R8-1]
CCDS86280.1 [Q9H0R8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_113600.1, NM_031412.2 [Q9H0R8-1]
XP_005253401.1, XM_005253344.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000266458; ENSP00000266458; ENSG00000139112 [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112 [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112 [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112 [Q9H0R8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23710

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23710

UCSC genome browser

More...
UCSCi
uc001qxs.4 human [Q9H0R8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF287012 mRNA Translation: AAK55962.1
AF087847 mRNA Translation: AAK20399.1
JN663881 mRNA Translation: AEZ06294.1
AL136676 mRNA Translation: CAB66611.1
AK303581 mRNA Translation: BAG64599.1
CR533480 mRNA Translation: CAG38511.1
AC115676 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96164.1
BC009309 mRNA Translation: AAH09309.1
BC028315 mRNA Translation: AAH28315.1
CCDSiCCDS8620.1 [Q9H0R8-1]
CCDS86280.1 [Q9H0R8-2]
RefSeqiNP_113600.1, NM_031412.2 [Q9H0R8-1]
XP_005253401.1, XM_005253344.4

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L8JNMR-A2-115[»]
2R2QX-ray1.65A/B3-111[»]
5DPTX-ray2.90A/B2-117[»]
5LXHX-ray1.58A/B/C1-117[»]
5LXIX-ray1.44B/D1-117[»]
6HOIX-ray1.14A/B1-117[»]
6HOLX-ray1.40A/B1-117[»]
SMRiQ9H0R8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117223, 79 interactors
DIPiDIP-35597N
ELMiQ9H0R8
IntActiQ9H0R8, 535 interactors
MINTiQ9H0R8
STRINGi9606.ENSP00000266458

PTM databases

iPTMnetiQ9H0R8
PhosphoSitePlusiQ9H0R8

Polymorphism and mutation databases

BioMutaiGABARAPL1
DMDMi44887973

Proteomic databases

EPDiQ9H0R8
jPOSTiQ9H0R8
MassIVEiQ9H0R8
MaxQBiQ9H0R8
PaxDbiQ9H0R8
PeptideAtlasiQ9H0R8
PRIDEiQ9H0R8
ProteomicsDBi5710
80321 [Q9H0R8-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23710
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000266458; ENSP00000266458; ENSG00000139112 [Q9H0R8-1]
ENST00000421801; ENSP00000411256; ENSG00000139112 [Q9H0R8-2]
ENST00000543602; ENSP00000445857; ENSG00000139112 [Q9H0R8-2]
ENST00000545887; ENSP00000444186; ENSG00000139112 [Q9H0R8-1]
GeneIDi23710
KEGGihsa:23710
UCSCiuc001qxs.4 human [Q9H0R8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23710
DisGeNETi23710

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GABARAPL1
HGNCiHGNC:4068 GABARAPL1
HPAiHPA051386
HPA065883
MIMi607420 gene
neXtProtiNX_Q9H0R8
OpenTargetsiENSG00000139112
PharmGKBiPA28481

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1654 Eukaryota
ENOG4111JAT LUCA
GeneTreeiENSGT00940000156876
HOGENOMiHOG000070205
InParanoidiQ9H0R8
KOiK08341
OMAiVICERAP
OrthoDBi1508198at2759
PhylomeDBiQ9H0R8
TreeFamiTF314556

Enzyme and pathway databases

ReactomeiR-HSA-1632852 Macroautophagy
SIGNORiQ9H0R8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GABARAPL1 human
EvolutionaryTraceiQ9H0R8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23710

Pharos

More...
Pharosi
Q9H0R8
PMAP-CutDBiQ9H0R8

Protein Ontology

More...
PROi
PR:Q9H0R8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000139112 Expressed in 241 organ(s), highest expression level in primary visual cortex
ExpressionAtlasiQ9H0R8 baseline and differential
GenevisibleiQ9H0R8 HS

Family and domain databases

InterProiView protein in InterPro
IPR004241 Atg8-like
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR10969 PTHR10969, 1 hit
PfamiView protein in Pfam
PF02991 Atg8, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGBRL1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H0R8
Secondary accession number(s): B4E0Y7, Q6FIE6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: March 1, 2001
Last modified: September 18, 2019
This is version 172 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again