Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic 5'-nucleotidase 3A

Gene

NT5C3A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m7GMP) (PubMed:24603684). CMP seems to be the preferred substrate (PubMed:15968458).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=15 µM for m7GMP (at 37 degrees Celsius)1 Publication
  2. KM=66 µM for CMP1 Publication
  3. KM=80 µM for CMP (at 37 degrees Celsius)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei88Nucleophile1 Publication1
    <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi88Magnesium1 Publication1
    Active sitei90Proton donor1 Publication1
    Metal bindingi90Magnesium; via carbonyl oxygen1 Publication1
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei135CMPBy similarity1
    Binding sitei135N(7)-methyl-GMPBy similarity1
    Binding sitei156N(7)-methyl-GMPBy similarity1
    Binding sitei252SubstrateBy similarity1
    Metal bindingi277Magnesium1 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • 5'-nucleotidase activity Source: UniProtKB
    • magnesium ion binding Source: UniProtKB
    • nucleotide binding Source: UniProtKB-KW
    • tRNA 2'-phosphotransferase activity Source: UniProtKB

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Transferase
    Biological processNucleotide metabolism
    LigandMagnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    3.1.3.91 2681

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-73621 Pyrimidine catabolism

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q9H0P0

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Cytosolic 5'-nucleotidase 3A2 Publications (EC:3.1.3.52 Publications)
    Alternative name(s):
    7-methylguanosine phosphate-specific 5'-nucleotidase1 Publication (EC:3.1.3.911 Publication)
    Short name:
    7-methylguanosine nucleotidase
    Cytosolic 5'-nucleotidase 3
    Cytosolic 5'-nucleotidase III
    Short name:
    cN-III
    Pyrimidine 5'-nucleotidase 1
    Short name:
    P5'N-1
    Short name:
    P5N-1
    Short name:
    PN-I
    Uridine 5'-monophosphate hydrolase 1
    p36
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:NT5C3A
    Synonyms:NT5C3, P5N1, UMPH1
    ORF Names:HSPC233
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000122643.18

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:17820 NT5C3A

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    606224 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9H0P0

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    P5N deficiency (P5ND)8 Publications
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionAutosomal recessive condition causing hemolytic anemia characterized by marked basophilic stippling and the accumulation of high concentrations of pyrimidine nucleotides within the erythrocyte. It is implicated in the anemia of lead poisoning and is possibly associated with learning difficulties.
    See also OMIM:266120
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07316095R → G in P5ND. 1 Publication1
    Natural variantiVAR_073161113C → R in P5ND; reduced catalytic activity especially towards UMP. 1 Publication1
    Natural variantiVAR_023511137D → V in P5ND; reduced catalytic activity. 2 PublicationsCorresponds to variant dbSNP:rs104894025EnsemblClinVar.1
    Natural variantiVAR_023512181L → P in P5ND; reduced catalytic activity in vitro; reduced protein stability in vivo, probably through increased proteasomal degradation. 3 Publications1
    Natural variantiVAR_073162207G → R in P5ND; reduced catalytic activity especially towards UMP. 2 Publications1
    Natural variantiVAR_023513229N → S in P5ND; almost complete loss of catalytic activity. 3 PublicationsCorresponds to variant dbSNP:rs104894028EnsemblClinVar.1
    Natural variantiVAR_023514280G → R in P5ND; greatly reduced catalytic activity. 3 PublicationsCorresponds to variant dbSNP:rs104894029EnsemblClinVar.1
    Natural variantiVAR_073163297I → T in P5ND. 2 Publications1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi88D → N: Loss of nucleotidase and phosphotransferase activity. 1 Publication1
    Mutagenesisi89F → A: Almost complete loss of nucleotidase and phosphotransferase activity. 1 Publication1
    Mutagenesisi90D → N: Loss of nucleotidase and phosphotransferase activity. 1 Publication1
    Mutagenesisi135E → D: No effect on nucleotidase activity. Almost complete loss of phosphotransferase activity. 1 Publication1
    Mutagenesisi232D → N: No effect on nucleotidase and phosphotransferase activity. 1 Publication1
    Mutagenesisi233F → A: Almost complete loss of nucleotidase and phosphotransferase activity. 1 Publication1
    Mutagenesisi234D → N: No effect on nucleotidase and phosphotransferase activity. 1 Publication1

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    51251

    MalaCards human disease database

    More...
    MalaCardsi
    NT5C3A
    MIMi266120 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000122643

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    35120 Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA31802

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    NT5C3A

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    117949804

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000643871 – 336Cytosolic 5'-nucleotidase 3AAdd BLAST336

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei278PhosphoserineBy similarity1

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9H0P0

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9H0P0

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9H0P0

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9H0P0

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    80305
    80306 [Q9H0P0-1]
    80307 [Q9H0P0-2]
    80308 [Q9H0P0-3]

    PTM databases

    DEPOD human dephosphorylation database

    More...
    DEPODi
    Q9H0P0

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9H0P0

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9H0P0

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.2 Publications

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    Isoform 2 is induced by interferon alpha in Raji cells in association with lupus inclusions.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000122643 Expressed in 98 organ(s), highest expression level in quadriceps femoris

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9H0P0 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9H0P0 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA010630
    HPA029058

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer.1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    119408, 25 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9H0P0, 11 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000242210

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1336
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    Q9H0P0

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9H0P0

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q9H0P0

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni203 – 204Substrate binding1 Publication2

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the pyrimidine 5'-nucleotidase family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3128 Eukaryota
    ENOG410ZQJ8 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00390000012959

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG059750

    KEGG Orthology (KO)

    More...
    KOi
    K01081

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    YMIEWWT

    Database of Orthologous Groups

    More...
    OrthoDBi
    EOG091G0BCN

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9H0P0

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF314663

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd07504 HAD_5NT, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.40.50.1000, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR036412 HAD-like_sf
    IPR023214 HAD_sf
    IPR006434 Pyrimidine_nucleotidase_eu

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF05822 UMPH-1, 1 hit

    Structure-Function Linkage Database

    More...
    SFLDi
    SFLDG01128 C1.4:_5'-Nucleotidase_Like, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF56784 SSF56784, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR01544 HAD-SF-IE, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 2 (identifier: Q9H0P0-4) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MRAPSMDRAA VARVGAVASA SVCALVAGVV LAQYIFTLKR KTGRKTKIIE
    60 70 80 90 100
    MMPEFQKSSV RIKNPTRVEE IICGLIKGGA AKLQIITDFD MTLSRFSYKG
    110 120 130 140 150
    KRCPTCHNII DNCKLVTDEC RKKLLQLKEK YYAIEVDPVL TVEEKYPYMV
    160 170 180 190 200
    EWYTKSHGLL VQQALPKAKL KEIVAESDVM LKEGYENFFD KLQQHSIPVF
    210 220 230 240 250
    IFSAGIGDVL EEVIRQAGVY HPNVKVVSNF MDFDETGVLK GFKGELIHVF
    260 270 280 290 300
    NKHDGALRNT EYFNQLKDNS NIILLGDSQG DLRMADGVAN VEHILKIGYL
    310 320 330
    NDRVDELLEK YMDSYDIVLV QDESLEVANS ILQKIL
    Length:336
    Mass (Da):37,948
    Last modified:November 14, 2006 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC5D75CCF1BB61021
    GO
    Isoform 1 (identifier: Q9H0P0-1) [UniParc]FASTAAdd to basket
    Also known as: P5N-I

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIE → MTNQESAVHVK

    Show »
    Length:297
    Mass (Da):33,915
    Checksum:iFB91A66DD2273598
    GO
    Isoform 3 (identifier: Q9H0P0-2) [UniParc]FASTAAdd to basket
    Also known as: p36

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: Missing.

    Show »
    Length:286
    Mass (Da):32,690
    Checksum:i29313E2790194ED9
    GO
    Isoform 4 (identifier: Q9H0P0-3) [UniParc]FASTAAdd to basket
    Also known as: P5N-R

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: Missing.

    Show »
    Length:285
    Mass (Da):32,559
    Checksum:iCB3B6812C90A5578
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    X6RM59X6RM59_HUMAN
    5'-nucleotidase
    NT5C3A
    331Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    B9A035B9A035_HUMAN
    Cytosolic 5'-nucleotidase 3A
    NT5C3A
    205Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9K084C9K084_HUMAN
    Cytosolic 5'-nucleotidase 3A
    NT5C3A
    42Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    F8WDR0F8WDR0_HUMAN
    Cytosolic 5'-nucleotidase 3A
    NT5C3A
    54Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence AAF36153 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
    The sequence AAG33630 differs from that shown. Reason: Frameshift at several positions.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti95R → K AA sequence (PubMed:8557639).Curated1
    Sequence conflicti144E → Q AA sequence (PubMed:8557639).Curated1
    Sequence conflicti329N → R AA sequence (PubMed:8557639).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_07316095R → G in P5ND. 1 Publication1
    Natural variantiVAR_073161113C → R in P5ND; reduced catalytic activity especially towards UMP. 1 Publication1
    Natural variantiVAR_023511137D → V in P5ND; reduced catalytic activity. 2 PublicationsCorresponds to variant dbSNP:rs104894025EnsemblClinVar.1
    Natural variantiVAR_023512181L → P in P5ND; reduced catalytic activity in vitro; reduced protein stability in vivo, probably through increased proteasomal degradation. 3 Publications1
    Natural variantiVAR_073162207G → R in P5ND; reduced catalytic activity especially towards UMP. 2 Publications1
    Natural variantiVAR_023513229N → S in P5ND; almost complete loss of catalytic activity. 3 PublicationsCorresponds to variant dbSNP:rs104894028EnsemblClinVar.1
    Natural variantiVAR_023514280G → R in P5ND; greatly reduced catalytic activity. 3 PublicationsCorresponds to variant dbSNP:rs104894029EnsemblClinVar.1
    Natural variantiVAR_073163297I → T in P5ND. 2 Publications1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0156241 – 51Missing in isoform 4. 1 PublicationAdd BLAST51
    Alternative sequenceiVSP_0215651 – 50MRAPS…TKIIE → MTNQESAVHVK in isoform 1. 2 PublicationsAdd BLAST50
    Alternative sequenceiVSP_0156231 – 50Missing in isoform 3. 2 PublicationsAdd BLAST50

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AF312735 mRNA Translation: AAG33630.1 Sequence problems.
    AL136716 mRNA Translation: CAB66650.1
    AK290118 mRNA Translation: BAF82807.1
    AK314109 mRNA Translation: BAG36802.1
    CR533518 mRNA Translation: CAG38549.1
    AC074338 Genomic DNA No translation available.
    AC083863 Genomic DNA No translation available.
    CH471073 Genomic DNA Translation: EAW94007.1
    CH471073 Genomic DNA Translation: EAW94008.1
    BC013292 mRNA Translation: AAH13292.2
    BC015856 mRNA Translation: AAH15856.2
    BC066914 mRNA Translation: AAH66914.1
    BC071652 mRNA Translation: AAH71652.2
    AF151067 mRNA Translation: AAF36153.1 Different initiation.

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS34617.1 [Q9H0P0-1]
    CCDS55101.1 [Q9H0P0-3]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001002009.1, NM_001002009.2 [Q9H0P0-1]
    NP_001002010.1, NM_001002010.2
    NP_001159590.1, NM_001166118.2 [Q9H0P0-3]
    NP_057573.2, NM_016489.12 [Q9H0P0-1]
    XP_011513711.1, XM_011515409.2

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.487933

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000381626; ENSP00000371039; ENSG00000122643 [Q9H0P0-3]
    ENST00000396152; ENSP00000379456; ENSG00000122643 [Q9H0P0-1]
    ENST00000405342; ENSP00000385261; ENSG00000122643 [Q9H0P0-1]
    ENST00000409467; ENSP00000387166; ENSG00000122643 [Q9H0P0-3]
    ENST00000620705; ENSP00000484415; ENSG00000122643 [Q9H0P0-4]
    ENST00000643244; ENSP00000496364; ENSG00000122643 [Q9H0P0-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    51251

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:51251

    UCSC genome browser

    More...
    UCSCi
    uc003tdi.5 human [Q9H0P0-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF312735 mRNA Translation: AAG33630.1 Sequence problems.
    AL136716 mRNA Translation: CAB66650.1
    AK290118 mRNA Translation: BAF82807.1
    AK314109 mRNA Translation: BAG36802.1
    CR533518 mRNA Translation: CAG38549.1
    AC074338 Genomic DNA No translation available.
    AC083863 Genomic DNA No translation available.
    CH471073 Genomic DNA Translation: EAW94007.1
    CH471073 Genomic DNA Translation: EAW94008.1
    BC013292 mRNA Translation: AAH13292.2
    BC015856 mRNA Translation: AAH15856.2
    BC066914 mRNA Translation: AAH66914.1
    BC071652 mRNA Translation: AAH71652.2
    AF151067 mRNA Translation: AAF36153.1 Different initiation.
    CCDSiCCDS34617.1 [Q9H0P0-1]
    CCDS55101.1 [Q9H0P0-3]
    RefSeqiNP_001002009.1, NM_001002009.2 [Q9H0P0-1]
    NP_001002010.1, NM_001002010.2
    NP_001159590.1, NM_001166118.2 [Q9H0P0-3]
    NP_057573.2, NM_016489.12 [Q9H0P0-1]
    XP_011513711.1, XM_011515409.2
    UniGeneiHs.487933

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2CN1X-ray2.67A64-336[»]
    2JGAX-ray3.01A64-336[»]
    2VKQX-ray2.50A64-336[»]
    ProteinModelPortaliQ9H0P0
    SMRiQ9H0P0
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi119408, 25 interactors
    IntActiQ9H0P0, 11 interactors
    STRINGi9606.ENSP00000242210

    PTM databases

    DEPODiQ9H0P0
    iPTMnetiQ9H0P0
    PhosphoSitePlusiQ9H0P0

    Polymorphism and mutation databases

    BioMutaiNT5C3A
    DMDMi117949804

    Proteomic databases

    EPDiQ9H0P0
    PaxDbiQ9H0P0
    PeptideAtlasiQ9H0P0
    PRIDEiQ9H0P0
    ProteomicsDBi80305
    80306 [Q9H0P0-1]
    80307 [Q9H0P0-2]
    80308 [Q9H0P0-3]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    51251
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000381626; ENSP00000371039; ENSG00000122643 [Q9H0P0-3]
    ENST00000396152; ENSP00000379456; ENSG00000122643 [Q9H0P0-1]
    ENST00000405342; ENSP00000385261; ENSG00000122643 [Q9H0P0-1]
    ENST00000409467; ENSP00000387166; ENSG00000122643 [Q9H0P0-3]
    ENST00000620705; ENSP00000484415; ENSG00000122643 [Q9H0P0-4]
    ENST00000643244; ENSP00000496364; ENSG00000122643 [Q9H0P0-1]
    GeneIDi51251
    KEGGihsa:51251
    UCSCiuc003tdi.5 human [Q9H0P0-4]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    51251
    DisGeNETi51251
    EuPathDBiHostDB:ENSG00000122643.18

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    NT5C3A
    HGNCiHGNC:17820 NT5C3A
    HPAiHPA010630
    HPA029058
    MalaCardsiNT5C3A
    MIMi266120 phenotype
    606224 gene
    neXtProtiNX_Q9H0P0
    OpenTargetsiENSG00000122643
    Orphaneti35120 Hemolytic anemia due to pyrimidine 5' nucleotidase deficiency
    PharmGKBiPA31802

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3128 Eukaryota
    ENOG410ZQJ8 LUCA
    GeneTreeiENSGT00390000012959
    HOVERGENiHBG059750
    KOiK01081
    OMAiYMIEWWT
    OrthoDBiEOG091G0BCN
    PhylomeDBiQ9H0P0
    TreeFamiTF314663

    Enzyme and pathway databases

    BRENDAi3.1.3.91 2681
    ReactomeiR-HSA-73621 Pyrimidine catabolism
    SABIO-RKiQ9H0P0

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    NT5C3A human
    EvolutionaryTraceiQ9H0P0

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    NT5C3

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    51251

    Protein Ontology

    More...
    PROi
    PR:Q9H0P0

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000122643 Expressed in 98 organ(s), highest expression level in quadriceps femoris
    ExpressionAtlasiQ9H0P0 baseline and differential
    GenevisibleiQ9H0P0 HS

    Family and domain databases

    CDDicd07504 HAD_5NT, 1 hit
    Gene3Di3.40.50.1000, 1 hit
    InterProiView protein in InterPro
    IPR036412 HAD-like_sf
    IPR023214 HAD_sf
    IPR006434 Pyrimidine_nucleotidase_eu
    PfamiView protein in Pfam
    PF05822 UMPH-1, 1 hit
    SFLDiSFLDG01128 C1.4:_5'-Nucleotidase_Like, 1 hit
    SUPFAMiSSF56784 SSF56784, 1 hit
    TIGRFAMsiTIGR01544 HAD-SF-IE, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5NT3A_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H0P0
    Secondary accession number(s): A8K253
    , B2RAA5, B8ZZC4, Q6IPZ1, Q6NXS6, Q7L3G6, Q9P0P5, Q9UC42, Q9UC43, Q9UC44, Q9UC45
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2005
    Last sequence update: November 14, 2006
    Last modified: December 5, 2018
    This is version 165 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again