Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Enkurin domain-containing protein 1

Gene

ENKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Enkurin domain-containing protein 1
Gene namesi
Name:ENKD1
Synonyms:C16orf48
ORF Names:UNQ6410/PRO21183
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000124074.11
HGNCiHGNC:25246 ENKD1
neXtProtiNX_Q9H0I2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000124074
PharmGKBiPA142672256

Polymorphism and mutation databases

BioMutaiENKD1
DMDMi74752565

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002659311 – 346Enkurin domain-containing protein 1Add BLAST346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei91PhosphoserineCombined sources1
Modified residuei136PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9H0I2
MaxQBiQ9H0I2
PaxDbiQ9H0I2
PeptideAtlasiQ9H0I2
PRIDEiQ9H0I2
ProteomicsDBi80281
80282 [Q9H0I2-2]

PTM databases

iPTMnetiQ9H0I2
PhosphoSitePlusiQ9H0I2

Expressioni

Gene expression databases

BgeeiENSG00000124074 Expressed in 173 organ(s), highest expression level in testis
CleanExiHS_C16orf48
ExpressionAtlasiQ9H0I2 baseline and differential
GenevisibleiQ9H0I2 HS

Organism-specific databases

HPAiHPA041163
HPA041478

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi123875, 42 interactors
IntActiQ9H0I2, 211 interactors
MINTiQ9H0I2

Structurei

3D structure databases

ProteinModelPortaliQ9H0I2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini251 – 343EnkurinPROSITE-ProRule annotationAdd BLAST93

Phylogenomic databases

eggNOGiENOG410II0X Eukaryota
ENOG4111NPF LUCA
GeneTreeiENSGT00390000018139
HOGENOMiHOG000007786
HOVERGENiHBG081309
InParanoidiQ9H0I2
OMAiPKRKDPK
OrthoDBiEOG091G06NH
PhylomeDBiQ9H0I2
TreeFamiTF328494

Family and domain databases

InterProiView protein in InterPro
IPR027710 ENKD1
IPR027012 Enkurin_dom
PANTHERiPTHR21490:SF2 PTHR21490:SF2, 1 hit
PfamiView protein in Pfam
PF13864 Enkurin, 1 hit
PROSITEiView protein in PROSITE
PS51665 ENKURIN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0I2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD
60 70 80 90 100
TTAPRGPCIG PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH
110 120 130 140 150
EKENLRRIRE IQKRFREQER SREQGQPRPL KALWRSPKYD KVESRVKAQL
160 170 180 190 200
QEPGPASGTE SAHFLRAHSR CGPGLPPPHV SSPQPTPPGP EAKEPGLGVD
210 220 230 240 250
FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT QKGHVPHYLL
260 270 280 290 300
ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR
310 320 330 340
ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD
Length:346
Mass (Da):38,759
Last modified:March 1, 2001 - v1
Checksum:iEDB07D64A0BB23FF
GO
Isoform 2 (identifier: Q9H0I2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,546
Checksum:iF87899DB5874FF4C
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
R4GN60R4GN60_HUMAN
Enkurin domain-containing protein 1
ENKD1
225Annotation score:
A0A087X0D0A0A087X0D0_HUMAN
Enkurin domain-containing protein 1
ENKD1
89Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0219041 – 118Missing in isoform 2. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_021905119 – 149ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136786 mRNA Translation: CAB66720.1
AY358834 mRNA Translation: AAQ89193.1
BC008284 mRNA Translation: AAH08284.1
CCDSiCCDS10844.1 [Q9H0I2-1]
RefSeqiNP_115516.1, NM_032140.2 [Q9H0I2-1]
UniGeneiHs.729159

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074 [Q9H0I2-1]
GeneIDi84080
KEGGihsa:84080
UCSCiuc002etw.2 human [Q9H0I2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136786 mRNA Translation: CAB66720.1
AY358834 mRNA Translation: AAQ89193.1
BC008284 mRNA Translation: AAH08284.1
CCDSiCCDS10844.1 [Q9H0I2-1]
RefSeqiNP_115516.1, NM_032140.2 [Q9H0I2-1]
UniGeneiHs.729159

3D structure databases

ProteinModelPortaliQ9H0I2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123875, 42 interactors
IntActiQ9H0I2, 211 interactors
MINTiQ9H0I2

PTM databases

iPTMnetiQ9H0I2
PhosphoSitePlusiQ9H0I2

Polymorphism and mutation databases

BioMutaiENKD1
DMDMi74752565

Proteomic databases

EPDiQ9H0I2
MaxQBiQ9H0I2
PaxDbiQ9H0I2
PeptideAtlasiQ9H0I2
PRIDEiQ9H0I2
ProteomicsDBi80281
80282 [Q9H0I2-2]

Protocols and materials databases

DNASUi84080
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074 [Q9H0I2-1]
GeneIDi84080
KEGGihsa:84080
UCSCiuc002etw.2 human [Q9H0I2-1]

Organism-specific databases

CTDi84080
EuPathDBiHostDB:ENSG00000124074.11
GeneCardsiENKD1
H-InvDBiHIX0013154
HGNCiHGNC:25246 ENKD1
HPAiHPA041163
HPA041478
neXtProtiNX_Q9H0I2
OpenTargetsiENSG00000124074
PharmGKBiPA142672256
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II0X Eukaryota
ENOG4111NPF LUCA
GeneTreeiENSGT00390000018139
HOGENOMiHOG000007786
HOVERGENiHBG081309
InParanoidiQ9H0I2
OMAiPKRKDPK
OrthoDBiEOG091G06NH
PhylomeDBiQ9H0I2
TreeFamiTF328494

Miscellaneous databases

ChiTaRSiENKD1 human
GeneWikiiC16orf48
GenomeRNAii84080
PROiPR:Q9H0I2

Gene expression databases

BgeeiENSG00000124074 Expressed in 173 organ(s), highest expression level in testis
CleanExiHS_C16orf48
ExpressionAtlasiQ9H0I2 baseline and differential
GenevisibleiQ9H0I2 HS

Family and domain databases

InterProiView protein in InterPro
IPR027710 ENKD1
IPR027012 Enkurin_dom
PANTHERiPTHR21490:SF2 PTHR21490:SF2, 1 hit
PfamiView protein in Pfam
PF13864 Enkurin, 1 hit
PROSITEiView protein in PROSITE
PS51665 ENKURIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiENKD1_HUMAN
AccessioniPrimary (citable) accession number: Q9H0I2
Secondary accession number(s): Q6UWD7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again