Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (07 Oct 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Enkurin domain-containing protein 1

Gene

ENKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9H0I2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Enkurin domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ENKD1
Synonyms:C16orf48
ORF Names:UNQ6410/PRO21183
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000124074.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25246, ENKD1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H0I2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84080

Open Targets

More...
OpenTargetsi
ENSG00000124074

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672256

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H0I2, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ENKD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74752565

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002659311 – 346Enkurin domain-containing protein 1Add BLAST346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei91PhosphoserineCombined sources1
Modified residuei136PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H0I2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H0I2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H0I2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H0I2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H0I2

PeptideAtlas

More...
PeptideAtlasi
Q9H0I2

PRoteomics IDEntifications database

More...
PRIDEi
Q9H0I2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80281 [Q9H0I2-1]
80282 [Q9H0I2-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H0I2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H0I2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124074, Expressed in testis and 190 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H0I2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H0I2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000124074, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q9H0I2
With#Exp.IntAct
ABI1 - isoform 5 [Q8IZP0-5]3EBI-744099,EBI-11743294
ABI2 - isoform 2 [Q9NYB9-2]6EBI-744099,EBI-11096309
ACOT7 - isoform 4 [O00154-4]3EBI-744099,EBI-12007918
AKAP8L [Q9ULX6]3EBI-744099,EBI-357530
ANKRD23 [Q86SG2]3EBI-744099,EBI-5661893
ANKRD49 [Q8WVL7]3EBI-744099,EBI-9381820
ARMC5 [Q96C12]3EBI-744099,EBI-6425121
ARSA [P15289]3EBI-744099,EBI-2117357
ASB3 - isoform 3 [Q9Y575-3]3EBI-744099,EBI-14199987
AVPI1 [Q5T686]3EBI-744099,EBI-8640233
BANP - isoform 2 [Q8N9N5-2]3EBI-744099,EBI-11524452
BCAS2 [O75934]3EBI-744099,EBI-1050106
BCAS4 - isoform 3 [Q8TDM0-3]3EBI-744099,EBI-13025473
BEGAIN [Q9BUH8]4EBI-744099,EBI-742722
BEX3 [Q00994]3EBI-744099,EBI-741753
BHLHB9 [Q6PI77]3EBI-744099,EBI-11519926
BLZF1 [Q9H2G9]5EBI-744099,EBI-2548012
BRAT1 [Q6PJG6]3EBI-744099,EBI-10826195
C19orf54 - isoform 3 [Q5BKX5-3]3EBI-744099,EBI-11976299
C1orf105 [O95561]3EBI-744099,EBI-10191951
CALCOCO1 [Q9P1Z2]3EBI-744099,EBI-749920
CALCOCO2 [Q13137]4EBI-744099,EBI-739580
CBY1 [Q9Y3M2]3EBI-744099,EBI-947308
CBY2 [Q8NA61]3EBI-744099,EBI-741724
CBY2 - isoform 2 [Q8NA61-2]3EBI-744099,EBI-11524851
CCDC102B [Q68D86]6EBI-744099,EBI-10171570
CCDC13 [Q8IYE1]3EBI-744099,EBI-10961312
CCDC136 - isoform 2 [Q96JN2-2]3EBI-744099,EBI-10171416
CCDC28B - isoform 2 [Q9BUN5-3]3EBI-744099,EBI-12920646
CDCA4 [Q9BXL8]3EBI-744099,EBI-1773949
CDPF1 [Q6NVV7]3EBI-744099,EBI-2802782
CDR2 [Q01850]6EBI-744099,EBI-1181367
CEP55 [Q53EZ4]3EBI-744099,EBI-747776
CEP70 [Q8NHQ1]4EBI-744099,EBI-739624
CHCHD3 [Q9NX63]3EBI-744099,EBI-743375
CHIC2 [Q9UKJ5]3EBI-744099,EBI-741528
CHRDL2 - isoform 2 [Q6WN34-2]3EBI-744099,EBI-12593838
COA7 [Q96BR5]3EBI-744099,EBI-6269632
CTBP2 - isoform 3 [P56545-3]3EBI-744099,EBI-10171902
CYSRT1 [A8MQ03]3EBI-744099,EBI-3867333
DYDC1 [Q8WWB3]3EBI-744099,EBI-740680
ECM1 [Q16610]3EBI-744099,EBI-947964
EFHC2 [Q5JST6]3EBI-744099,EBI-2349927
EIF4G1 - isoform 9 [Q04637-9]3EBI-744099,EBI-12012124
EYA2 - isoform 2 [O00167-2]3EBI-744099,EBI-12807776
EZHIP [Q86X51]3EBI-744099,EBI-12827735
FAM102A [Q5T9C2]3EBI-744099,EBI-10246318
FAM228A [Q86W67]3EBI-744099,EBI-12958227
FAM90A1 [Q86YD7]3EBI-744099,EBI-6658203
FCHSD2 - isoform 3 [O94868-3]3EBI-744099,EBI-11958845
FKBP6 [O75344]3EBI-744099,EBI-744771
FOS [P01100]3EBI-744099,EBI-852851
FOSB [P53539]3EBI-744099,EBI-2806743
FSBP [O95073]3EBI-744099,EBI-1059030
FSD2 [A1L4K1]3EBI-744099,EBI-5661036
GADD45G [O95257]5EBI-744099,EBI-448202
GADD45GIP1 [Q8TAE8]3EBI-744099,EBI-372506
GET4 [Q7L5D6]3EBI-744099,EBI-711823
GFAP [P14136]3EBI-744099,EBI-744302
GIGYF1 [O75420]3EBI-744099,EBI-947774
GOLGA2 [Q08379]3EBI-744099,EBI-618309
GOLGA6A [Q9NYA3]3EBI-744099,EBI-11163335
GOLGA6L9 [A6NEM1]3EBI-744099,EBI-5916454
GRHL3 - isoform 2 [Q8TE85-2]3EBI-744099,EBI-12827521
GRIPAP1 [Q4V328]3EBI-744099,EBI-717919
HMBOX1 [Q6NT76]3EBI-744099,EBI-2549423
HMGXB4 [Q9UGU5]3EBI-744099,EBI-7261162
HNRNPH1 [P31943]3EBI-744099,EBI-351590
HOOK2 - isoform 2 [Q96ED9-2]3EBI-744099,EBI-10961706
HOXA1 [P49639]5EBI-744099,EBI-740785
HSF2BP [O75031]3EBI-744099,EBI-7116203
HSPB2 [Q16082]3EBI-744099,EBI-739395
ID2 [Q02363]3EBI-744099,EBI-713450
IGF1 - isoform 2 [P05019-2]3EBI-744099,EBI-12837046
IGFBP6 [P24592]3EBI-744099,EBI-947015
IKBKG [Q9Y6K9]3EBI-744099,EBI-81279
IKZF3 [Q9UKT9]3EBI-744099,EBI-747204
JAKMIP1 [Q96N16]3EBI-744099,EBI-2680803
KIAA1328 [Q86T90]3EBI-744099,EBI-3437878
KIFC3 - isoform 4 [Q9BVG8-5]3EBI-744099,EBI-14069005
KLHL20 [Q9BS75]3EBI-744099,EBI-10693436
KLHL26 [Q53HC5]3EBI-744099,EBI-724915
KRT14 [P02533]3EBI-744099,EBI-702178
KRT15 [P19012]3EBI-744099,EBI-739566
KRT31 [Q15323]3EBI-744099,EBI-948001
KRT35 [Q92764]3EBI-744099,EBI-1058674
KRT40 [Q6A162]3EBI-744099,EBI-10171697
KRTAP10-5 [P60370]3EBI-744099,EBI-10172150
KRTAP10-8 [P60410]3EBI-744099,EBI-10171774
KRTAP11-1 [Q8IUC1]3EBI-744099,EBI-1052037
KRTAP12-1 [P59990]3EBI-744099,EBI-10210845
KRTAP13-2 [Q52LG2]3EBI-744099,EBI-11953846
KRTAP19-1 [Q8IUB9]3EBI-744099,EBI-12811111
KRTAP19-5 [Q3LI72]3EBI-744099,EBI-1048945
KRTAP19-6 [Q3LI70]3EBI-744099,EBI-12805508
KRTAP4-11 [Q9BYQ6]3EBI-744099,EBI-10302392
KRTAP5-9 [P26371]3EBI-744099,EBI-3958099
KRTAP6-2 [Q3LI66]3EBI-744099,EBI-11962084
LAS2 [Q8IYD9]3EBI-744099,EBI-749878
LDOC1 [O95751]3EBI-744099,EBI-740738
LHX3 - isoform B [Q9UBR4-2]3EBI-744099,EBI-12039345
LIN7B [Q9HAP6]3EBI-744099,EBI-821335
LMO2 - isoform 3 [P25791-3]3EBI-744099,EBI-11959475
LRRC61 [Q9BV99]3EBI-744099,EBI-2350424
LURAP1 [Q96LR2]3EBI-744099,EBI-741355
LZTS1 [Q9Y250]3EBI-744099,EBI-1216080
MAPK9 [P45984]3EBI-744099,EBI-713568
MATN4 - isoform 2 [O95460-2]3EBI-744099,EBI-12072296
MDFI [Q99750]8EBI-744099,EBI-724076
MEIS3 - isoform 3 [Q99687-3]3EBI-744099,EBI-18582591
MESD [Q14696]3EBI-744099,EBI-6165891
METTL27 [Q8N6F8]3EBI-744099,EBI-8487781
MID2 - isoform 2 [Q9UJV3-2]3EBI-744099,EBI-10172526
MIF4GD - isoform 2 [A9UHW6-2]3EBI-744099,EBI-9118295
MIPOL1 [Q8TD10]6EBI-744099,EBI-2548751
MISP [Q8IVT2]3EBI-744099,EBI-2555085
MKRN3 [Q13064]4EBI-744099,EBI-2340269
MLH1 [P40692]3EBI-744099,EBI-744248
MORN3 [Q6PF18]3EBI-744099,EBI-9675802
MORN5 [Q5VZ52]3EBI-744099,EBI-12835568
MRNIP [Q6NTE8]3EBI-744099,EBI-2857471
MRPL28 [Q13084]3EBI-744099,EBI-723426
MRPL38 [Q96DV4]3EBI-744099,EBI-720441
MTUS2 - isoform 2 [Q5JR59-3]3EBI-744099,EBI-11522433
MYF5 [P13349]5EBI-744099,EBI-17491620
MYOZ3 [Q8TDC0]3EBI-744099,EBI-5662487
N4BP3 [O15049]3EBI-744099,EBI-2512055
NAB2 [Q15742]3EBI-744099,EBI-8641936
NCKIPSD - isoform 3 [Q9NZQ3-3]3EBI-744099,EBI-10963850
NDUFB7 [P17568]3EBI-744099,EBI-1246238
NEFL [I6L9F6]3EBI-744099,EBI-10178578
NFKBIA [P25963]3EBI-744099,EBI-307386
NHLRC4 [P0CG21]3EBI-744099,EBI-12868744
OOEP [A6NGQ2]3EBI-744099,EBI-18583589
PAK5 [Q9P286]3EBI-744099,EBI-741896
PARVA [Q9NVD7]3EBI-744099,EBI-747655
PDLIM7 [Q9NR12]6EBI-744099,EBI-350517
PDZD4 [Q17RL8]3EBI-744099,EBI-10239064
PHC2 [Q8IXK0]4EBI-744099,EBI-713786
PIBF1 [Q4G0R1]3EBI-744099,EBI-14066006
PICK1 [Q9NRD5]3EBI-744099,EBI-79165
PIH1D2 [Q8WWB5]3EBI-744099,EBI-10232538
PIK3R3 [Q92569]3EBI-744099,EBI-79893
PKNOX2 [Q96KN3]3EBI-744099,EBI-2692890
PNMA1 [Q8ND90]4EBI-744099,EBI-302345
PNMA2 [Q9UL42]7EBI-744099,EBI-302355
POLR3C [Q9BUI4]3EBI-744099,EBI-5452779
PPP2R3C [Q969Q6]3EBI-744099,EBI-2561661
PRDM14 [Q9GZV8]3EBI-744099,EBI-3957793
PRDM6 [Q9NQX0]3EBI-744099,EBI-11320284
RBCK1 [Q9BYM8]3EBI-744099,EBI-2340624
RBM11 [P57052]3EBI-744099,EBI-741332
RCN1 [Q15293]3EBI-744099,EBI-948278
RUBCN [Q92622]3EBI-744099,EBI-2952709
RUNDC3A - isoform 3 [Q59EK9-3]3EBI-744099,EBI-11957366
SERTAD3 [Q9UJW9]3EBI-744099,EBI-748621
SLC15A2 [Q16348]3EBI-744099,EBI-12806032
SMYD3 [Q9H7B4]3EBI-744099,EBI-347919
SNRNP48 [Q6IEG0]3EBI-744099,EBI-2876632
SORBS3 [O60504]3EBI-744099,EBI-741237
SPATA46 [Q5T0L3]3EBI-744099,EBI-750105
SPDEF [O95238]3EBI-744099,EBI-12811275
SPOCK2 [Q92563]3EBI-744099,EBI-311086
SPSB3 [Q6PJ21]6EBI-744099,EBI-3937206
SRGAP3 [Q8IXS7]3EBI-744099,EBI-18616594
STAC3 [Q96MF2]4EBI-744099,EBI-745680
STMN3 [Q9NZ72]3EBI-744099,EBI-725557
STXBP4 [Q08AL9]3EBI-744099,EBI-10318905
TENT5B [Q96A09]3EBI-744099,EBI-752030
TNNI1 [P19237]3EBI-744099,EBI-746692
TNS2 [Q63HR2]3EBI-744099,EBI-949753
TOX2 - isoform 3 [Q96NM4-3]3EBI-744099,EBI-12815137
TRAF1 [Q13077]3EBI-744099,EBI-359224
TRAF2 [Q12933]7EBI-744099,EBI-355744
TRIM23 [P36406]3EBI-744099,EBI-740098
TRIM27 [P14373]3EBI-744099,EBI-719493
TRIM35 - isoform 2 [Q9UPQ4-2]3EBI-744099,EBI-17716262
TRIM54 [Q9BYV2]6EBI-744099,EBI-2130429
TSC1 [Q86WV8]3EBI-744099,EBI-12806590
TSEN15 [Q8WW01]3EBI-744099,EBI-372432
TTC23 - isoform 3 [Q5W5X9-3]3EBI-744099,EBI-9090990
UBXN11 [Q5T124]3EBI-744099,EBI-746004
UBXN11 - isoform 6 [Q5T124-6]3EBI-744099,EBI-11524408
USH1C - isoform 4 [Q9Y6N9-4]3EBI-744099,EBI-11523636
USH1G [Q495M9]3EBI-744099,EBI-8601749
USHBP1 [Q8N6Y0]3EBI-744099,EBI-739895
USP20 [A0A024R8A9]3EBI-744099,EBI-14096082
VBP1 [P61758]3EBI-744099,EBI-357430
VPS37B [Q9H9H4]3EBI-744099,EBI-4400866
VWC2 [Q2TAL6]3EBI-744099,EBI-11957238
WDR62 [O43379]4EBI-744099,EBI-714790
WWOX - isoform 5 [Q9NZC7-5]3EBI-744099,EBI-12040603
ZBTB14 [O43829]3EBI-744099,EBI-10176632
ZC2HC1C - isoform 2 [Q53FD0-2]3EBI-744099,EBI-14104088
ZFP90 [Q8TF47]3EBI-744099,EBI-11419867
ZNF143 [P52747]3EBI-744099,EBI-2849334
ZNF426 [Q9BUY5]3EBI-744099,EBI-743265
ZNF436 [Q9C0F3]3EBI-744099,EBI-8489702
ZNF511 [Q8NB15]3EBI-744099,EBI-10269136
ZNF581 [Q9P0T4]3EBI-744099,EBI-745520
ZNF76 [P36508]3EBI-744099,EBI-7254550
ZNF774 [Q6NX45]3EBI-744099,EBI-10251462
ZRANB1 [Q9UGI0]3EBI-744099,EBI-527853
A0A1U9X8X83EBI-744099,EBI-17234977
Q6ZN963EBI-744099,EBI-10255097

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123875, 213 interactors

Protein interaction database and analysis system

More...
IntActi
Q9H0I2, 223 interactors

Molecular INTeraction database

More...
MINTi
Q9H0I2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000243878

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H0I2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H0I2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini251 – 343EnkurinPROSITE-ProRule annotationAdd BLAST93

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QU1P, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153866

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_068901_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H0I2

Identification of Orthologs from Complete Genome Data

More...
OMAi
RFREQEH

Database of Orthologous Groups

More...
OrthoDBi
1383928at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H0I2

TreeFam database of animal gene trees

More...
TreeFami
TF328494

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027710, ENKD1
IPR027012, Enkurin_dom

The PANTHER Classification System

More...
PANTHERi
PTHR21490:SF2, PTHR21490:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13864, Enkurin, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51665, ENKURIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0I2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCEGPSRISG PIPPDPTLCP DNYRRPTSAQ GRLEGNALKL DLLTSDRALD
60 70 80 90 100
TTAPRGPCIG PGAGEILERG QRGVGDVLLQ LEGISLGPGA SLKRKDPKDH
110 120 130 140 150
EKENLRRIRE IQKRFREQER SREQGQPRPL KALWRSPKYD KVESRVKAQL
160 170 180 190 200
QEPGPASGTE SAHFLRAHSR CGPGLPPPHV SSPQPTPPGP EAKEPGLGVD
210 220 230 240 250
FIRHNARAAK RAPRRHSCSL QVLAQVLEQQ RQAQEHYNAT QKGHVPHYLL
260 270 280 290 300
ERRDLWRREA EARKQSQPDP AMPPGHTRMP ENQRLETLTK LLQSQSQLLR
310 320 330 340
ELVLLPAGAD SLRAQSHRAE LDRKLVQVEE AIKIFSRPKV FVKMDD
Length:346
Mass (Da):38,759
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEDB07D64A0BB23FF
GO
Isoform 2 (identifier: Q9H0I2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-118: Missing.
     119-149: ERSREQGQPRPLKALWRSPKYDKVESRVKAQ → MDAKVRRAKMARVLQLEPQTSACLLSLLCPA

Show »
Length:228
Mass (Da):25,546
Checksum:iF87899DB5874FF4C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
R4GN60R4GN60_HUMAN
Enkurin domain-containing protein 1
ENKD1
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0D0A0A087X0D0_HUMAN
Enkurin domain-containing protein 1
ENKD1
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0219041 – 118Missing in isoform 2. 1 PublicationAdd BLAST118
Alternative sequenceiVSP_021905119 – 149ERSRE…RVKAQ → MDAKVRRAKMARVLQLEPQT SACLLSLLCPA in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL136786 mRNA Translation: CAB66720.1
AY358834 mRNA Translation: AAQ89193.1
BC008284 mRNA Translation: AAH08284.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10844.1 [Q9H0I2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_115516.1, NM_032140.2 [Q9H0I2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000243878; ENSP00000243878; ENSG00000124074 [Q9H0I2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84080

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84080

UCSC genome browser

More...
UCSCi
uc002etw.2, human [Q9H0I2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136786 mRNA Translation: CAB66720.1
AY358834 mRNA Translation: AAQ89193.1
BC008284 mRNA Translation: AAH08284.1
CCDSiCCDS10844.1 [Q9H0I2-1]
RefSeqiNP_115516.1, NM_032140.2 [Q9H0I2-1]

3D structure databases

SMRiQ9H0I2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123875, 213 interactors
IntActiQ9H0I2, 223 interactors
MINTiQ9H0I2
STRINGi9606.ENSP00000243878

PTM databases

iPTMnetiQ9H0I2
PhosphoSitePlusiQ9H0I2

Polymorphism and mutation databases

BioMutaiENKD1
DMDMi74752565

Proteomic databases

EPDiQ9H0I2
jPOSTiQ9H0I2
MassIVEiQ9H0I2
MaxQBiQ9H0I2
PaxDbiQ9H0I2
PeptideAtlasiQ9H0I2
PRIDEiQ9H0I2
ProteomicsDBi80281 [Q9H0I2-1]
80282 [Q9H0I2-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29606, 121 antibodies

The DNASU plasmid repository

More...
DNASUi
84080

Genome annotation databases

EnsembliENST00000243878; ENSP00000243878; ENSG00000124074 [Q9H0I2-1]
GeneIDi84080
KEGGihsa:84080
UCSCiuc002etw.2, human [Q9H0I2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84080
DisGeNETi84080
EuPathDBiHostDB:ENSG00000124074.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ENKD1
HGNCiHGNC:25246, ENKD1
HPAiENSG00000124074, Low tissue specificity
neXtProtiNX_Q9H0I2
OpenTargetsiENSG00000124074
PharmGKBiPA142672256

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QU1P, Eukaryota
GeneTreeiENSGT00940000153866
HOGENOMiCLU_068901_0_0_1
InParanoidiQ9H0I2
OMAiRFREQEH
OrthoDBi1383928at2759
PhylomeDBiQ9H0I2
TreeFamiTF328494

Enzyme and pathway databases

PathwayCommonsiQ9H0I2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84080, 13 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ENKD1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C16orf48

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84080
PharosiQ9H0I2, Tdark

Protein Ontology

More...
PROi
PR:Q9H0I2
RNActiQ9H0I2, protein

Gene expression databases

BgeeiENSG00000124074, Expressed in testis and 190 other tissues
ExpressionAtlasiQ9H0I2, baseline and differential
GenevisibleiQ9H0I2, HS

Family and domain databases

InterProiView protein in InterPro
IPR027710, ENKD1
IPR027012, Enkurin_dom
PANTHERiPTHR21490:SF2, PTHR21490:SF2, 1 hit
PfamiView protein in Pfam
PF13864, Enkurin, 1 hit
PROSITEiView protein in PROSITE
PS51665, ENKURIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiENKD1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H0I2
Secondary accession number(s): Q6UWD7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: March 1, 2001
Last modified: October 7, 2020
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again