Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bromodomain-containing protein 8

Gene

BRD8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome.3 Publications

Caution

It is uncertain whether Met-1 or Met-32 is the initiator.Curated

GO - Molecular functioni

  • DNA-binding transcription factor activity Source: UniProtKB
  • thyroid hormone receptor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator
Biological processGrowth regulation, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Names & Taxonomyi

Protein namesi
Recommended name:
Bromodomain-containing protein 8
Alternative name(s):
Skeletal muscle abundant protein
Skeletal muscle abundant protein 2
Thyroid hormone receptor coactivating protein of 120 kDa
Short name:
TrCP120
p120
Gene namesi
Name:BRD8
Synonyms:SMAP, SMAP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000112983.17
HGNCiHGNC:19874 BRD8
MIMi602848 gene
neXtProtiNX_Q9H0E9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi10902
OpenTargetsiENSG00000112983
PharmGKBiPA134923194

Chemistry databases

ChEMBLiCHEMBL3588731

Polymorphism and mutation databases

BioMutaiBRD8
DMDMi313104080

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002111851 – 1235Bromodomain-containing protein 8Add BLAST1235

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei85N6-acetyllysineBy similarity1
Modified residuei383PhosphoserineBy similarity1
Modified residuei387PhosphoserineCombined sources1
Cross-linki469Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei481N6-acetyllysine; alternateCombined sources1
Cross-linki481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki509Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki575Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei579PhosphoserineCombined sources1
Cross-linki612Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei621PhosphoserineCombined sources1
Modified residuei637PhosphoserineCombined sources1
Modified residuei641PhosphoserineCombined sources1
Isoform 3 (identifier: Q9H0E9-3)
Modified residuei124PhosphothreonineCombined sources1
Modified residuei128PhosphoserineCombined sources1
Modified residuei144PhosphoserineCombined sources1
Isoform 2 (identifier: Q9H0E9-2)
Modified residuei264PhosphothreonineCombined sources1
Modified residuei268PhosphoserineCombined sources1
Modified residuei284PhosphoserineCombined sources1
Modified residuei924PhosphoserineCombined sources1
Isoform 4 (identifier: Q9H0E9-4)
Modified residuei264PhosphothreonineCombined sources1
Modified residuei268PhosphoserineCombined sources1
Modified residuei284PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9H0E9
MaxQBiQ9H0E9
PaxDbiQ9H0E9
PeptideAtlasiQ9H0E9
PRIDEiQ9H0E9
ProteomicsDBi80265
80266 [Q9H0E9-2]
80267 [Q9H0E9-3]
80268 [Q9H0E9-4]

PTM databases

iPTMnetiQ9H0E9
PhosphoSitePlusiQ9H0E9

Miscellaneous databases

PMAP-CutDBiQ9H0E9

Expressioni

Tissue specificityi

Expressed in adipose tissue, brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000112983 Expressed in 233 organ(s), highest expression level in testis
CleanExiHS_BRD8
HS_SMAP2
ExpressionAtlasiQ9H0E9 baseline and differential
GenevisibleiQ9H0E9 HS

Organism-specific databases

HPAiHPA001841

Interactioni

Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein. Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. BRD8 isoform 2 interacts with RXRA/NR2B1 and THRB/ERBA2 (By similarity). Component of a SWR1-like complex.By similarity4 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi116108, 40 interactors
ComplexPortaliCPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H0E9
DIPiDIP-31762N
IntActiQ9H0E9, 24 interactors
MINTiQ9H0E9
STRINGi9606.ENSP00000254900

Chemistry databases

BindingDBiQ9H0E9

Structurei

3D structure databases

ProteinModelPortaliQ9H0E9
SMRiQ9H0E9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini724 – 794Bromo 1PROSITE-ProRule annotationAdd BLAST71
Domaini1120 – 1190Bromo 2PROSITE-ProRule annotationAdd BLAST71

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili97 – 171Sequence analysisAdd BLAST75

Keywords - Domaini

Bromodomain, Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IF07 Eukaryota
ENOG410Y97J LUCA
GeneTreeiENSGT00530000064262
HOGENOMiHOG000074125
HOVERGENiHBG050732
InParanoidiQ9H0E9
KOiK11321
OrthoDBiEOG091G05H0
PhylomeDBiQ9H0E9
TreeFamiTF106422

Family and domain databases

CDDicd05507 Bromo_brd8_like, 2 hits
Gene3Di1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR038002 BRD8
IPR037966 Brd8_Bromo_dom
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
PANTHERiPTHR15398:SF6 PTHR15398:SF6, 2 hits
PfamiView protein in Pfam
PF00439 Bromodomain, 2 hits
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 2 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0E9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGTGKHKL LSTGPTEPWS IREKLCLASS VMRSGDQNWV SVSRAIKPFA
60 70 80 90 100
EPGRPPDWFS QKHCASQYSE LLETTETPKR KRGEKGEVVE TVEDVIVRKL
110 120 130 140 150
TAERVEELKK VIKETQERYR RLKRDAELIQ AGHMDSRLDE LCNDIATKKK
160 170 180 190 200
LEEEEAEVKR KATDAAYQAR QAVKTPPRRL PTVMVRSPID SASPGGDYPL
210 220 230 240 250
GDLTPTTMEE ATSGVNESEM AVASGHLNST GVLLEVGGVL PMIHGGEIQQ
260 270 280 290 300
TPNTVAASPA ASGAPTLSRL LEAGPTQFTT PLASFTTVAS EPPVKLVPPP
310 320 330 340 350
VESVSQATIV MMPALPAPSS APAVSTTESV APVSQPDNCV PMEAVGDPHT
360 370 380 390 400
VTVSMDSSEI SMIINSIKEE CFRSGVAEAP VGSKAPSIDG KEELDLAEKM
410 420 430 440 450
DIAVSYTGEE LDFETVGDII AIIEDKVDDH PEVLDVAAVE AALSFCEEND
460 470 480 490 500
DPQSLPGPWE HPIQQERDKP VPLPAPEMTV KQERLDFEET ENKGIHELVD
510 520 530 540 550
IREPSAEIKV EPAEPEPVIS GAEIVAGVVP ATSMEPPELR SQDLDEELGS
560 570 580 590 600
TAAGEIVEAD VAIGKGDETP LTNVKTEASP ESMLSPSHGS NPIEDPLEAE
610 620 630 640 650
TQHKFEMSDS LKEESGTIFG SQIKDAPGED EEEDGVSEAA SLEEPKEEDQ
660 670 680 690 700
GEGYLSEMDN EPPVSESDDG FSIHNATLQS HTLADSIPSS PASSQFSVCS
710 720 730 740 750
EDQEAIQAQK IWKKAIMLVW RAAANHRYAN VFLQPVTDDI APGYHSIVQR
760 770 780 790 800
PMDLSTIKKN IENGLIRSTA EFQRDIMLMF QNAVMYNSSD HDVYHMAVEM
810 820 830 840 850
QRDVLEQIQQ FLATQLIMQT SESGISAKSL RGRDSTRKQD ASEKDSVPMG
860 870 880 890 900
SPAFLLSLFM GHEWVWLDSE QDHPNDSELS NDCRSLFSSW DSSLDLDVGN
910 920 930 940 950
WRETEDPEAE ELEESSPERE PSELLVGDGG SEESQEAARK ASHQNLLHFL
960 970 980 990 1000
SEVAYLMEPL CISSNESSEG CCPPSGTRQE GREIKASEGE RELCRETEEL
1010 1020 1030 1040 1050
SAKGDPLVAE KPLGENGKPE VASAPSVICT VQGLLTESEE GEAQQESKGE
1060 1070 1080 1090 1100
DQGEVYVSEM EDQPPSGECD DAFNIKETPL VDTLFSHATS SKLTDLSQDD
1110 1120 1130 1140 1150
PVQDHLLFKK TLLPVWKMIA SHRFSSPFLK PVSERQAPGY KDVVKRPMDL
1160 1170 1180 1190 1200
TSLKRNLSKG RIRTMAQFLR DLMLMFQNAV MYNDSDHHVY HMAVEMRQEV
1210 1220 1230
LEQIQVLNIW LDKRKGSSSL EGEPANPVDD GKPVF
Length:1,235
Mass (Da):135,336
Last modified:November 30, 2010 - v2
Checksum:i3738078C77FC17D1
GO
Isoform 2 (identifier: Q9H0E9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK
     879-1235: Missing.

Show »
Length:951
Mass (Da):102,839
Checksum:i80C0A7A6ACB4E8ED
GO
Isoform 3 (identifier: Q9H0E9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-147: MATGTGKHKL...LDELCNDIAT → MSFAMTL
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     263-301: Missing.
     845-859: Missing.
     860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK
     879-1235: Missing.

Show »
Length:757
Mass (Da):81,354
Checksum:iC1D728727505F85D
GO
Isoform 4 (identifier: Q9H0E9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     263-332: Missing.
     846-846: S → G
     847-975: Missing.
     979-992: QEGREIKASEGERE → GRRCAIEADMKMKK
     993-1235: Missing.

Show »
Length:866
Mass (Da):94,297
Checksum:i3400AEB14E9412FC
GO

Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCW3B5MCW3_HUMAN
Bromodomain-containing protein 8
BRD8
878Annotation score:
H7C127H7C127_HUMAN
Bromodomain-containing protein 8
BRD8
892Annotation score:
H7C128H7C128_HUMAN
Bromodomain-containing protein 8
BRD8
857Annotation score:
H7C179H7C179_HUMAN
Bromodomain-containing protein 8
BRD8
861Annotation score:
H0YA84H0YA84_HUMAN
Bromodomain-containing protein 8
BRD8
195Annotation score:
H7C2P4H7C2P4_HUMAN
Bromodomain-containing protein 8
BRD8
187Annotation score:
D6RID0D6RID0_HUMAN
Bromodomain-containing protein 8
BRD8
48Annotation score:
H0YAH7H0YAH7_HUMAN
Bromodomain-containing protein 8
BRD8
292Annotation score:
F8WDX5F8WDX5_HUMAN
Bromodomain-containing protein 8
BRD8
39Annotation score:
F8WBH2F8WBH2_HUMAN
Bromodomain-containing protein 8
BRD8
79Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAB87858 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH08039 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH08076 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAA63925 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti306Q → H in AAB87858 (PubMed:9368056).Curated1
Sequence conflicti557V → L in CAA60949 (PubMed:8611617).Curated1
Sequence conflicti557V → L in CAA63925 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_030695490T → M1 PublicationCorresponds to variant dbSNP:rs11750814Ensembl.1
Natural variantiVAR_048428896L → P. Corresponds to variant dbSNP:rs6883021Ensembl.1
Natural variantiVAR_0484291198Q → R6 PublicationsCorresponds to variant dbSNP:rs412051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128791 – 147MATGT…NDIAT → MSFAMTL in isoform 3. 1 PublicationAdd BLAST147
Alternative sequenceiVSP_012880215V → VTPGTLPSTPVTSFPGIPDT LPPGSAPLEAPMTPVTDDSP QKKMLGQKATPPPSPLLSEL LKKGSLLPTSPRLV in isoform 2, isoform 3 and isoform 4. 5 Publications1
Alternative sequenceiVSP_023187263 – 332Missing in isoform 4. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_012881263 – 301Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_012882845 – 859Missing in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_023188846S → G in isoform 4. 1 Publication1
Alternative sequenceiVSP_023189847 – 975Missing in isoform 4. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_012883860 – 878MGHEW…PNDSE → DGGTRGRRCAIEADMKMKK in isoform 2 and isoform 3. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_012884879 – 1235Missing in isoform 2 and isoform 3. 4 PublicationsAdd BLAST357
Alternative sequenceiVSP_023190979 – 992QEGRE…EGERE → GRRCAIEADMKMKK in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_023191993 – 1235Missing in isoform 4. 1 PublicationAdd BLAST243

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87613 mRNA Translation: CAA60949.1
AL136823 mRNA Translation: CAB66757.1
AB209079 mRNA Translation: BAD92316.1
AC109442 Genomic DNA No translation available.
AC113382 Genomic DNA No translation available.
BC008039 mRNA Translation: AAH08039.1 Different initiation.
BC008076 mRNA Translation: AAH08076.1 Different initiation.
AF016270 mRNA Translation: AAB87858.1 Different initiation.
X94234 mRNA Translation: CAA63925.1 Different initiation.
CCDSiCCDS34241.1 [Q9H0E9-2]
CCDS4198.1 [Q9H0E9-1]
CCDS54907.1 [Q9H0E9-4]
PIRiS58225
S68142
RefSeqiNP_001157798.1, NM_001164326.1 [Q9H0E9-4]
NP_001287890.1, NM_001300961.1
NP_001287891.1, NM_001300962.1
NP_001287895.1, NM_001300966.1 [Q9H0E9-3]
NP_006687.3, NM_006696.3 [Q9H0E9-2]
NP_631938.1, NM_139199.1
UniGeneiHs.519337

Genome annotation databases

EnsembliENST00000230901; ENSP00000230901; ENSG00000112983 [Q9H0E9-2]
ENST00000254900; ENSP00000254900; ENSG00000112983 [Q9H0E9-1]
ENST00000411594; ENSP00000394330; ENSG00000112983 [Q9H0E9-4]
GeneIDi10902
KEGGihsa:10902
UCSCiuc003lcf.2 human [Q9H0E9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87613 mRNA Translation: CAA60949.1
AL136823 mRNA Translation: CAB66757.1
AB209079 mRNA Translation: BAD92316.1
AC109442 Genomic DNA No translation available.
AC113382 Genomic DNA No translation available.
BC008039 mRNA Translation: AAH08039.1 Different initiation.
BC008076 mRNA Translation: AAH08076.1 Different initiation.
AF016270 mRNA Translation: AAB87858.1 Different initiation.
X94234 mRNA Translation: CAA63925.1 Different initiation.
CCDSiCCDS34241.1 [Q9H0E9-2]
CCDS4198.1 [Q9H0E9-1]
CCDS54907.1 [Q9H0E9-4]
PIRiS58225
S68142
RefSeqiNP_001157798.1, NM_001164326.1 [Q9H0E9-4]
NP_001287890.1, NM_001300961.1
NP_001287891.1, NM_001300962.1
NP_001287895.1, NM_001300966.1 [Q9H0E9-3]
NP_006687.3, NM_006696.3 [Q9H0E9-2]
NP_631938.1, NM_139199.1
UniGeneiHs.519337

3D structure databases

ProteinModelPortaliQ9H0E9
SMRiQ9H0E9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116108, 40 interactors
ComplexPortaliCPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H0E9
DIPiDIP-31762N
IntActiQ9H0E9, 24 interactors
MINTiQ9H0E9
STRINGi9606.ENSP00000254900

Chemistry databases

BindingDBiQ9H0E9
ChEMBLiCHEMBL3588731

PTM databases

iPTMnetiQ9H0E9
PhosphoSitePlusiQ9H0E9

Polymorphism and mutation databases

BioMutaiBRD8
DMDMi313104080

Proteomic databases

EPDiQ9H0E9
MaxQBiQ9H0E9
PaxDbiQ9H0E9
PeptideAtlasiQ9H0E9
PRIDEiQ9H0E9
ProteomicsDBi80265
80266 [Q9H0E9-2]
80267 [Q9H0E9-3]
80268 [Q9H0E9-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000230901; ENSP00000230901; ENSG00000112983 [Q9H0E9-2]
ENST00000254900; ENSP00000254900; ENSG00000112983 [Q9H0E9-1]
ENST00000411594; ENSP00000394330; ENSG00000112983 [Q9H0E9-4]
GeneIDi10902
KEGGihsa:10902
UCSCiuc003lcf.2 human [Q9H0E9-1]

Organism-specific databases

CTDi10902
DisGeNETi10902
EuPathDBiHostDB:ENSG00000112983.17
GeneCardsiBRD8
HGNCiHGNC:19874 BRD8
HPAiHPA001841
MIMi602848 gene
neXtProtiNX_Q9H0E9
OpenTargetsiENSG00000112983
PharmGKBiPA134923194
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF07 Eukaryota
ENOG410Y97J LUCA
GeneTreeiENSGT00530000064262
HOGENOMiHOG000074125
HOVERGENiHBG050732
InParanoidiQ9H0E9
KOiK11321
OrthoDBiEOG091G05H0
PhylomeDBiQ9H0E9
TreeFamiTF106422

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRSiBRD8 human
GeneWikiiBRD8
GenomeRNAii10902
PMAP-CutDBiQ9H0E9
PROiPR:Q9H0E9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112983 Expressed in 233 organ(s), highest expression level in testis
CleanExiHS_BRD8
HS_SMAP2
ExpressionAtlasiQ9H0E9 baseline and differential
GenevisibleiQ9H0E9 HS

Family and domain databases

CDDicd05507 Bromo_brd8_like, 2 hits
Gene3Di1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR038002 BRD8
IPR037966 Brd8_Bromo_dom
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
PANTHERiPTHR15398:SF6 PTHR15398:SF6, 2 hits
PfamiView protein in Pfam
PF00439 Bromodomain, 2 hits
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiBRD8_HUMAN
AccessioniPrimary (citable) accession number: Q9H0E9
Secondary accession number(s): O43178
, Q15355, Q58AB0, Q59GN0, Q969M9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: November 30, 2010
Last modified: September 12, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again