Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (26 Feb. 2020)
Sequence version 2 (30 Nov. 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Bromodomain-containing protein 8

Gene

BRD8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a coactivator during transcriptional activation by hormone-activated nuclear receptors (NR). Isoform 2 stimulates transcriptional activation by AR/DHTR, ESR1/NR3A1, RXRA/NR2B1 and THRB/ERBA2. At least isoform 1 and isoform 2 are components of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AZ1 from the nucleosome.3 Publications

Caution

It is uncertain whether Met-1 or Met-32 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA-binding transcription factor activity Source: UniProtKB
  • nuclear receptor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator
Biological processGrowth regulation, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-3214847 HATs acetylate histones

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bromodomain-containing protein 8
Alternative name(s):
Skeletal muscle abundant protein
Skeletal muscle abundant protein 2
Thyroid hormone receptor coactivating protein of 120 kDa
Short name:
TrCP120
p120
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BRD8
Synonyms:SMAP, SMAP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19874 BRD8

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602848 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H0E9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10902

Open Targets

More...
OpenTargetsi
ENSG00000112983

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134923194

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9H0E9 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3588731

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BRD8

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104080

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002111851 – 1235Bromodomain-containing protein 8Add BLAST1235

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei85N6-acetyllysineBy similarity1
Modified residuei383PhosphoserineBy similarity1
Modified residuei387PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki469Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei481N6-acetyllysine; alternateCombined sources1
Cross-linki481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki481Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki509Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki575Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei579PhosphoserineCombined sources1
Cross-linki612Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei621PhosphoserineCombined sources1
Modified residuei637PhosphoserineCombined sources1
Modified residuei641PhosphoserineCombined sources1
Isoform 3 (identifier: Q9H0E9-3)
Modified residuei124PhosphothreonineCombined sources1
Modified residuei128PhosphoserineCombined sources1
Modified residuei144PhosphoserineCombined sources1
Isoform 2 (identifier: Q9H0E9-2)
Modified residuei264PhosphothreonineCombined sources1
Modified residuei268PhosphoserineCombined sources1
Modified residuei284PhosphoserineCombined sources1
Modified residuei924PhosphoserineCombined sources1
Isoform 4 (identifier: Q9H0E9-4)
Modified residuei264PhosphothreonineCombined sources1
Modified residuei268PhosphoserineCombined sources1
Modified residuei284PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9H0E9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9H0E9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H0E9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9H0E9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H0E9

PeptideAtlas

More...
PeptideAtlasi
Q9H0E9

PRoteomics IDEntifications database

More...
PRIDEi
Q9H0E9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80265 [Q9H0E9-1]
80266 [Q9H0E9-2]
80267 [Q9H0E9-3]
80268 [Q9H0E9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H0E9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H0E9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in adipose tissue, brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000112983 Expressed in testis and 232 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9H0E9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H0E9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA001841

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the NuA4 histone acetyltransferase complex which contains the catalytic subunit KAT5/TIP60 and the subunits EP400, TRRAP/PAF400, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, ING3, actin, ACTL6A/BAF53A, MORF4L1/MRG15, MORF4L2/MRGX, MRGBP, YEATS4/GAS41, VPS72/YL1 and MEAF6. The NuA4 complex interacts with MYC and the adenovirus E1A protein.

Component of a NuA4-related complex which contains EP400, TRRAP/PAF400, SRCAP, BRD8/SMAP, EPC1, DMAP1/DNMAP1, RUVBL1/TIP49, RUVBL2, actin, ACTL6A/BAF53A, VPS72 and YEATS4/GAS41. BRD8 isoform 2 interacts with RXRA/NR2B1 and THRB/ERBA2 (By similarity).

Component of a SWR1-like complex.

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116108, 42 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-978 NuA4 histone acetyltransferase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9H0E9

Database of interacting proteins

More...
DIPi
DIP-31762N

Protein interaction database and analysis system

More...
IntActi
Q9H0E9, 36 interactors

Molecular INTeraction database

More...
MINTi
Q9H0E9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000254900

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9H0E9

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9H0E9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9H0E9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini724 – 794Bromo 1PROSITE-ProRule annotationAdd BLAST71
Domaini1120 – 1190Bromo 2PROSITE-ProRule annotationAdd BLAST71

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili97 – 171Sequence analysisAdd BLAST75

Keywords - Domaini

Bromodomain, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IF07 Eukaryota
ENOG410Y97J LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000064262

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H0E9

KEGG Orthology (KO)

More...
KOi
K11321

Database of Orthologous Groups

More...
OrthoDBi
1509761at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H0E9

TreeFam database of animal gene trees

More...
TreeFami
TF106422

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05507 Bromo_brd8_like, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.920.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038002 BRD8
IPR037966 Brd8_Bromo_dom
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR15398:SF6 PTHR15398:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00439 Bromodomain, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00503 BROMODOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00297 BROMO, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50014 BROMODOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0E9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGTGKHKL LSTGPTEPWS IREKLCLASS VMRSGDQNWV SVSRAIKPFA
60 70 80 90 100
EPGRPPDWFS QKHCASQYSE LLETTETPKR KRGEKGEVVE TVEDVIVRKL
110 120 130 140 150
TAERVEELKK VIKETQERYR RLKRDAELIQ AGHMDSRLDE LCNDIATKKK
160 170 180 190 200
LEEEEAEVKR KATDAAYQAR QAVKTPPRRL PTVMVRSPID SASPGGDYPL
210 220 230 240 250
GDLTPTTMEE ATSGVNESEM AVASGHLNST GVLLEVGGVL PMIHGGEIQQ
260 270 280 290 300
TPNTVAASPA ASGAPTLSRL LEAGPTQFTT PLASFTTVAS EPPVKLVPPP
310 320 330 340 350
VESVSQATIV MMPALPAPSS APAVSTTESV APVSQPDNCV PMEAVGDPHT
360 370 380 390 400
VTVSMDSSEI SMIINSIKEE CFRSGVAEAP VGSKAPSIDG KEELDLAEKM
410 420 430 440 450
DIAVSYTGEE LDFETVGDII AIIEDKVDDH PEVLDVAAVE AALSFCEEND
460 470 480 490 500
DPQSLPGPWE HPIQQERDKP VPLPAPEMTV KQERLDFEET ENKGIHELVD
510 520 530 540 550
IREPSAEIKV EPAEPEPVIS GAEIVAGVVP ATSMEPPELR SQDLDEELGS
560 570 580 590 600
TAAGEIVEAD VAIGKGDETP LTNVKTEASP ESMLSPSHGS NPIEDPLEAE
610 620 630 640 650
TQHKFEMSDS LKEESGTIFG SQIKDAPGED EEEDGVSEAA SLEEPKEEDQ
660 670 680 690 700
GEGYLSEMDN EPPVSESDDG FSIHNATLQS HTLADSIPSS PASSQFSVCS
710 720 730 740 750
EDQEAIQAQK IWKKAIMLVW RAAANHRYAN VFLQPVTDDI APGYHSIVQR
760 770 780 790 800
PMDLSTIKKN IENGLIRSTA EFQRDIMLMF QNAVMYNSSD HDVYHMAVEM
810 820 830 840 850
QRDVLEQIQQ FLATQLIMQT SESGISAKSL RGRDSTRKQD ASEKDSVPMG
860 870 880 890 900
SPAFLLSLFM GHEWVWLDSE QDHPNDSELS NDCRSLFSSW DSSLDLDVGN
910 920 930 940 950
WRETEDPEAE ELEESSPERE PSELLVGDGG SEESQEAARK ASHQNLLHFL
960 970 980 990 1000
SEVAYLMEPL CISSNESSEG CCPPSGTRQE GREIKASEGE RELCRETEEL
1010 1020 1030 1040 1050
SAKGDPLVAE KPLGENGKPE VASAPSVICT VQGLLTESEE GEAQQESKGE
1060 1070 1080 1090 1100
DQGEVYVSEM EDQPPSGECD DAFNIKETPL VDTLFSHATS SKLTDLSQDD
1110 1120 1130 1140 1150
PVQDHLLFKK TLLPVWKMIA SHRFSSPFLK PVSERQAPGY KDVVKRPMDL
1160 1170 1180 1190 1200
TSLKRNLSKG RIRTMAQFLR DLMLMFQNAV MYNDSDHHVY HMAVEMRQEV
1210 1220 1230
LEQIQVLNIW LDKRKGSSSL EGEPANPVDD GKPVF
Length:1,235
Mass (Da):135,336
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3738078C77FC17D1
GO
Isoform 2 (identifier: Q9H0E9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK
     879-1235: Missing.

Show »
Length:951
Mass (Da):102,839
Checksum:i80C0A7A6ACB4E8ED
GO
Isoform 3 (identifier: Q9H0E9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-147: MATGTGKHKL...LDELCNDIAT → MSFAMTL
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     263-301: Missing.
     845-859: Missing.
     860-878: MGHEWVWLDSEQDHPNDSE → DGGTRGRRCAIEADMKMKK
     879-1235: Missing.

Show »
Length:757
Mass (Da):81,354
Checksum:iC1D728727505F85D
GO
Isoform 4 (identifier: Q9H0E9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-215: V → VTPGTLPSTPVTSFPGIPDTLPPGSAPLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLV
     263-332: Missing.
     846-846: S → G
     847-975: Missing.
     979-992: QEGREIKASEGERE → GRRCAIEADMKMKK
     993-1235: Missing.

Show »
Length:866
Mass (Da):94,297
Checksum:i3400AEB14E9412FC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCW3B5MCW3_HUMAN
Bromodomain-containing protein 8
BRD8
878Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C127H7C127_HUMAN
Bromodomain-containing protein 8
BRD8
892Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C128H7C128_HUMAN
Bromodomain-containing protein 8
BRD8
857Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C179H7C179_HUMAN
Bromodomain-containing protein 8
BRD8
861Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA84H0YA84_HUMAN
Bromodomain-containing protein 8
BRD8
195Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C026H7C026_HUMAN
Bromodomain-containing protein 8
BRD8
336Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAH7H0YAH7_HUMAN
Bromodomain-containing protein 8
BRD8
292Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2P4H7C2P4_HUMAN
Bromodomain-containing protein 8
BRD8
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8F9H0Y8F9_HUMAN
Bromodomain-containing protein 8
BRD8
36Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RID0D6RID0_HUMAN
Bromodomain-containing protein 8
BRD8
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB87858 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH08039 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH08076 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAA63925 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti306Q → H in AAB87858 (PubMed:9368056).Curated1
Sequence conflicti557V → L in CAA60949 (PubMed:8611617).Curated1
Sequence conflicti557V → L in CAA63925 (Ref. 7) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_030695490T → M1 PublicationCorresponds to variant dbSNP:rs11750814Ensembl.1
Natural variantiVAR_048428896L → P. Corresponds to variant dbSNP:rs6883021Ensembl.1
Natural variantiVAR_0484291198Q → R6 PublicationsCorresponds to variant dbSNP:rs412051Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0128791 – 147MATGT…NDIAT → MSFAMTL in isoform 3. 1 PublicationAdd BLAST147
Alternative sequenceiVSP_012880215V → VTPGTLPSTPVTSFPGIPDT LPPGSAPLEAPMTPVTDDSP QKKMLGQKATPPPSPLLSEL LKKGSLLPTSPRLV in isoform 2, isoform 3 and isoform 4. 5 Publications1
Alternative sequenceiVSP_023187263 – 332Missing in isoform 4. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_012881263 – 301Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_012882845 – 859Missing in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_023188846S → G in isoform 4. 1 Publication1
Alternative sequenceiVSP_023189847 – 975Missing in isoform 4. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_012883860 – 878MGHEW…PNDSE → DGGTRGRRCAIEADMKMKK in isoform 2 and isoform 3. 4 PublicationsAdd BLAST19
Alternative sequenceiVSP_012884879 – 1235Missing in isoform 2 and isoform 3. 4 PublicationsAdd BLAST357
Alternative sequenceiVSP_023190979 – 992QEGRE…EGERE → GRRCAIEADMKMKK in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_023191993 – 1235Missing in isoform 4. 1 PublicationAdd BLAST243

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X87613 mRNA Translation: CAA60949.1
AL136823 mRNA Translation: CAB66757.1
AB209079 mRNA Translation: BAD92316.1
AC109442 Genomic DNA No translation available.
AC113382 Genomic DNA No translation available.
BC008039 mRNA Translation: AAH08039.1 Different initiation.
BC008076 mRNA Translation: AAH08076.1 Different initiation.
AF016270 mRNA Translation: AAB87858.1 Different initiation.
X94234 mRNA Translation: CAA63925.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34241.1 [Q9H0E9-2]
CCDS4198.1 [Q9H0E9-1]
CCDS54907.1 [Q9H0E9-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
S58225
S68142

NCBI Reference Sequences

More...
RefSeqi
NP_001157798.1, NM_001164326.1 [Q9H0E9-4]
NP_001287890.1, NM_001300961.1
NP_001287891.1, NM_001300962.1
NP_001287895.1, NM_001300966.1 [Q9H0E9-3]
NP_006687.3, NM_006696.3 [Q9H0E9-2]
NP_631938.1, NM_139199.1 [Q9H0E9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000230901; ENSP00000230901; ENSG00000112983 [Q9H0E9-2]
ENST00000254900; ENSP00000254900; ENSG00000112983 [Q9H0E9-1]
ENST00000411594; ENSP00000394330; ENSG00000112983 [Q9H0E9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10902

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10902

UCSC genome browser

More...
UCSCi
uc003lcf.2 human [Q9H0E9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87613 mRNA Translation: CAA60949.1
AL136823 mRNA Translation: CAB66757.1
AB209079 mRNA Translation: BAD92316.1
AC109442 Genomic DNA No translation available.
AC113382 Genomic DNA No translation available.
BC008039 mRNA Translation: AAH08039.1 Different initiation.
BC008076 mRNA Translation: AAH08076.1 Different initiation.
AF016270 mRNA Translation: AAB87858.1 Different initiation.
X94234 mRNA Translation: CAA63925.1 Different initiation.
CCDSiCCDS34241.1 [Q9H0E9-2]
CCDS4198.1 [Q9H0E9-1]
CCDS54907.1 [Q9H0E9-4]
PIRiS58225
S68142
RefSeqiNP_001157798.1, NM_001164326.1 [Q9H0E9-4]
NP_001287890.1, NM_001300961.1
NP_001287891.1, NM_001300962.1
NP_001287895.1, NM_001300966.1 [Q9H0E9-3]
NP_006687.3, NM_006696.3 [Q9H0E9-2]
NP_631938.1, NM_139199.1 [Q9H0E9-1]

3D structure databases

SMRiQ9H0E9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116108, 42 interactors
ComplexPortaliCPX-978 NuA4 histone acetyltransferase complex
CORUMiQ9H0E9
DIPiDIP-31762N
IntActiQ9H0E9, 36 interactors
MINTiQ9H0E9
STRINGi9606.ENSP00000254900

Chemistry databases

BindingDBiQ9H0E9
ChEMBLiCHEMBL3588731

PTM databases

iPTMnetiQ9H0E9
PhosphoSitePlusiQ9H0E9

Polymorphism and mutation databases

BioMutaiBRD8
DMDMi313104080

Proteomic databases

EPDiQ9H0E9
jPOSTiQ9H0E9
MassIVEiQ9H0E9
MaxQBiQ9H0E9
PaxDbiQ9H0E9
PeptideAtlasiQ9H0E9
PRIDEiQ9H0E9
ProteomicsDBi80265 [Q9H0E9-1]
80266 [Q9H0E9-2]
80267 [Q9H0E9-3]
80268 [Q9H0E9-4]

Genome annotation databases

EnsembliENST00000230901; ENSP00000230901; ENSG00000112983 [Q9H0E9-2]
ENST00000254900; ENSP00000254900; ENSG00000112983 [Q9H0E9-1]
ENST00000411594; ENSP00000394330; ENSG00000112983 [Q9H0E9-4]
GeneIDi10902
KEGGihsa:10902
UCSCiuc003lcf.2 human [Q9H0E9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10902
DisGeNETi10902

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BRD8
HGNCiHGNC:19874 BRD8
HPAiHPA001841
MIMi602848 gene
neXtProtiNX_Q9H0E9
OpenTargetsiENSG00000112983
PharmGKBiPA134923194

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IF07 Eukaryota
ENOG410Y97J LUCA
GeneTreeiENSGT00530000064262
InParanoidiQ9H0E9
KOiK11321
OrthoDBi1509761at2759
PhylomeDBiQ9H0E9
TreeFamiTF106422

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BRD8 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BRD8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10902
PharosiQ9H0E9 Tbio

Protein Ontology

More...
PROi
PR:Q9H0E9
RNActiQ9H0E9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000112983 Expressed in testis and 232 other tissues
ExpressionAtlasiQ9H0E9 baseline and differential
GenevisibleiQ9H0E9 HS

Family and domain databases

CDDicd05507 Bromo_brd8_like, 2 hits
Gene3Di1.20.920.10, 2 hits
InterProiView protein in InterPro
IPR038002 BRD8
IPR037966 Brd8_Bromo_dom
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
PANTHERiPTHR15398:SF6 PTHR15398:SF6, 2 hits
PfamiView protein in Pfam
PF00439 Bromodomain, 2 hits
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00297 BROMO, 2 hits
SUPFAMiSSF47370 SSF47370, 2 hits
PROSITEiView protein in PROSITE
PS50014 BROMODOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBRD8_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H0E9
Secondary accession number(s): O43178
, Q15355, Q58AB0, Q59GN0, Q969M9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: November 30, 2010
Last modified: February 26, 2020
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again