Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

COMM domain-containing protein 4

Gene

COMMD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Down-regulates activation of NF-kappa-B.1 Publication1 Publication

Keywordsi

Biological processTranscription, Transcription regulation, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation

Names & Taxonomyi

Protein namesi
Recommended name:
COMM domain-containing protein 4
Gene namesi
Name:COMMD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000140365.15
HGNCiHGNC:26027 COMMD4
MIMi616701 gene
neXtProtiNX_Q9H0A8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000140365
PharmGKBiPA134993083

Polymorphism and mutation databases

DMDMi51316094

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000773931 – 199COMM domain-containing protein 4Add BLAST199

Proteomic databases

EPDiQ9H0A8
MaxQBiQ9H0A8
PaxDbiQ9H0A8
PeptideAtlasiQ9H0A8
PRIDEiQ9H0A8
ProteomicsDBi80236
80237 [Q9H0A8-2]

PTM databases

iPTMnetiQ9H0A8
PhosphoSitePlusiQ9H0A8

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000140365 Expressed in 221 organ(s), highest expression level in right testis
CleanExiHS_COMMD4
ExpressionAtlasiQ9H0A8 baseline and differential
GenevisibleiQ9H0A8 HS

Organism-specific databases

HPAiHPA066957

Interactioni

Subunit structurei

Interacts (via COMM domain) with COMMD1 (via COMM domain). Interacts with RELA, RELB, NFKB1/p105. Interacts with CCDC22, CCDC93, SCNN1B, CUL2, CUL3, CUL4A, CUL5, CUL7.5 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi120279, 49 interactors
CORUMiQ9H0A8
IntActiQ9H0A8, 18 interactors
STRINGi9606.ENSP00000267935

Structurei

3D structure databases

ProteinModelPortaliQ9H0A8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini130 – 199COMMPROSITE-ProRule annotationAdd BLAST70

Phylogenomic databases

eggNOGiENOG410IEAM Eukaryota
ENOG4111EZM LUCA
GeneTreeiENSGT00390000015516
HOGENOMiHOG000006594
HOVERGENiHBG051069
InParanoidiQ9H0A8
KOiK22560
PhylomeDBiQ9H0A8
TreeFamiTF317482

Family and domain databases

CDDicd04752 Commd4, 1 hit
InterProiView protein in InterPro
IPR017920 COMM
IPR037356 Commd4
PfamiView protein in Pfam
PF07258 COMM_domain, 1 hit
PROSITEiView protein in PROSITE
PS51269 COMM, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9H0A8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFRFCGDLD CPDWVLAEIS TLAKMSSVKL RLLCSQVLKE LLGQGIDYEK
60 70 80 90 100
ILKLTADAKF ESGDVKATVA VLSFILSSAA KHSVDGESLS SELQQLGLPK
110 120 130 140 150
EHAASLCRCY EEKQSPLQKH LRVCSLRMNR LAGVGWRVDY TLSSSLLQSV
160 170 180 190
EEPMVHLRLE VAAAPGTPAQ PVAMSLSADK FQVLLAELKQ AQTLMSSLG
Length:199
Mass (Da):21,764
Last modified:March 1, 2001 - v1
Checksum:i7B7B85234E3FB59B
GO
Isoform 2 (identifier: Q9H0A8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-187: MNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAE → K

Show »
Length:140
Mass (Da):15,458
Checksum:i8F3684CD4FE577CB
GO
Isoform 3 (identifier: Q9H0A8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-186: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:113
Mass (Da):12,291
Checksum:i6B823A5BFB64A54E
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BM91H3BM91_HUMAN
COMM domain-containing protein 4
COMMD4
211Annotation score:
H3BQF2H3BQF2_HUMAN
COMM domain-containing protein 4
COMMD4
146Annotation score:
A0A0B4J287A0A0B4J287_HUMAN
COMM domain-containing protein 4
COMMD4
177Annotation score:
H3BRX0H3BRX0_HUMAN
COMM domain-containing protein 4
COMMD4
110Annotation score:
H3BTV9H3BTV9_HUMAN
COMM domain-containing protein 4
COMMD4
52Annotation score:
H3BPG2H3BPG2_HUMAN
COMM domain-containing protein 4
COMMD4
136Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055664101 – 186Missing in isoform 3. CuratedAdd BLAST86
Alternative sequenceiVSP_011394128 – 187MNRLA…VLLAE → K in isoform 2. 2 PublicationsAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY542160 mRNA Translation: AAS22242.1
AL136872 mRNA Translation: CAB66806.1
CR533452 mRNA Translation: CAG38483.1
AK000459 mRNA Translation: BAA91178.1
AK314740 mRNA Translation: BAG37281.1
AC068338 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99263.1
BC000837 mRNA Translation: AAH00837.2
BC068998 mRNA Translation: AAH68998.1
CCDSiCCDS10277.1 [Q9H0A8-1]
CCDS66834.1 [Q9H0A8-2]
CCDS66835.1 [Q9H0A8-3]
RefSeqiNP_001271306.1, NM_001284377.1 [Q9H0A8-2]
NP_001271307.1, NM_001284378.1 [Q9H0A8-3]
NP_060298.2, NM_017828.4 [Q9H0A8-1]
UniGeneiHs.351327

Genome annotation databases

EnsembliENST00000267935; ENSP00000267935; ENSG00000140365 [Q9H0A8-1]
ENST00000338995; ENSP00000340867; ENSG00000140365 [Q9H0A8-2]
ENST00000480484; ENSP00000433662; ENSG00000140365 [Q9H0A8-1]
ENST00000567195; ENSP00000457693; ENSG00000140365 [Q9H0A8-3]
GeneIDi54939
KEGGihsa:54939
UCSCiuc002azy.5 human [Q9H0A8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY542160 mRNA Translation: AAS22242.1
AL136872 mRNA Translation: CAB66806.1
CR533452 mRNA Translation: CAG38483.1
AK000459 mRNA Translation: BAA91178.1
AK314740 mRNA Translation: BAG37281.1
AC068338 Genomic DNA No translation available.
CH471136 Genomic DNA Translation: EAW99263.1
BC000837 mRNA Translation: AAH00837.2
BC068998 mRNA Translation: AAH68998.1
CCDSiCCDS10277.1 [Q9H0A8-1]
CCDS66834.1 [Q9H0A8-2]
CCDS66835.1 [Q9H0A8-3]
RefSeqiNP_001271306.1, NM_001284377.1 [Q9H0A8-2]
NP_001271307.1, NM_001284378.1 [Q9H0A8-3]
NP_060298.2, NM_017828.4 [Q9H0A8-1]
UniGeneiHs.351327

3D structure databases

ProteinModelPortaliQ9H0A8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120279, 49 interactors
CORUMiQ9H0A8
IntActiQ9H0A8, 18 interactors
STRINGi9606.ENSP00000267935

PTM databases

iPTMnetiQ9H0A8
PhosphoSitePlusiQ9H0A8

Polymorphism and mutation databases

DMDMi51316094

Proteomic databases

EPDiQ9H0A8
MaxQBiQ9H0A8
PaxDbiQ9H0A8
PeptideAtlasiQ9H0A8
PRIDEiQ9H0A8
ProteomicsDBi80236
80237 [Q9H0A8-2]

Protocols and materials databases

DNASUi54939
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267935; ENSP00000267935; ENSG00000140365 [Q9H0A8-1]
ENST00000338995; ENSP00000340867; ENSG00000140365 [Q9H0A8-2]
ENST00000480484; ENSP00000433662; ENSG00000140365 [Q9H0A8-1]
ENST00000567195; ENSP00000457693; ENSG00000140365 [Q9H0A8-3]
GeneIDi54939
KEGGihsa:54939
UCSCiuc002azy.5 human [Q9H0A8-1]

Organism-specific databases

CTDi54939
EuPathDBiHostDB:ENSG00000140365.15
GeneCardsiCOMMD4
HGNCiHGNC:26027 COMMD4
HPAiHPA066957
MIMi616701 gene
neXtProtiNX_Q9H0A8
OpenTargetsiENSG00000140365
PharmGKBiPA134993083
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEAM Eukaryota
ENOG4111EZM LUCA
GeneTreeiENSGT00390000015516
HOGENOMiHOG000006594
HOVERGENiHBG051069
InParanoidiQ9H0A8
KOiK22560
PhylomeDBiQ9H0A8
TreeFamiTF317482

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation

Miscellaneous databases

ChiTaRSiCOMMD4 human
GeneWikiiCOMMD4
GenomeRNAii54939
PROiPR:Q9H0A8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140365 Expressed in 221 organ(s), highest expression level in right testis
CleanExiHS_COMMD4
ExpressionAtlasiQ9H0A8 baseline and differential
GenevisibleiQ9H0A8 HS

Family and domain databases

CDDicd04752 Commd4, 1 hit
InterProiView protein in InterPro
IPR017920 COMM
IPR037356 Commd4
PfamiView protein in Pfam
PF07258 COMM_domain, 1 hit
PROSITEiView protein in PROSITE
PS51269 COMM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCOMD4_HUMAN
AccessioniPrimary (citable) accession number: Q9H0A8
Secondary accession number(s): B2RBN4
, H3BUL2, Q7L637, Q9NX43
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again