Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (18 Sep 2019)
Sequence version 2 (25 Jan 2012)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger MYND domain-containing protein 15

Gene

ZMYND15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a transcriptional repressor through interaction with histone deacetylases (HDACs). May be important for spermiogenesis.1 PublicationBy similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri313 – 359MYND-typePROSITE-ProRule annotationAdd BLAST47

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation, Spermatogenesis, Transcription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger MYND domain-containing protein 15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZMYND15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20997 ZMYND15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614312 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9H091

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spermatogenic failure 14 (SPGF14)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder resulting in the absence (azoospermia) or reduction (oligozoospermia) of sperm in the semen, leading to male infertility.
Related information in OMIM

Organism-specific databases

DisGeNET

More...
DisGeNETi
84225

MalaCards human disease database

More...
MalaCardsi
ZMYND15
MIMi615842 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000141497

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
399805 Male infertility with azoospermia or oligozoospermia due to single gene mutation

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134873463

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZMYND15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
374095468

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002183171 – 742Zinc finger MYND domain-containing protein 15Add BLAST742

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9H091

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9H091

PeptideAtlas

More...
PeptideAtlasi
Q9H091

PRoteomics IDEntifications database

More...
PRIDEi
Q9H091

ProteomicsDB human proteome resource

More...
ProteomicsDBi
46881
80218 [Q9H091-1]
80219 [Q9H091-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9H091

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9H091

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000141497 Expressed in 96 organ(s), highest expression level in testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9H091 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023286

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HDAC1, HDAC3, HDAC6 and, to a lesser extent, with HDAC7.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000269289

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi110 – 186Glu-richAdd BLAST77
Compositional biasi707 – 724Pro-richAdd BLAST18

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri313 – 359MYND-typePROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMI3 Eukaryota
ENOG4111I8B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000000527

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231040

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9H091

Identification of Orthologs from Complete Genome Data

More...
OMAi
WWQLEAQ

Database of Orthologous Groups

More...
OrthoDBi
290771at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9H091

TreeFam database of animal gene trees

More...
TreeFami
TF336410

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002893 Znf_MYND

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01753 zf-MYND, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50865 ZF_MYND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9H091-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFVSGYRDE FLDFTALLFG WFRKFVAERG AVGTSLEGRC RQLEAQIRRL
60 70 80 90 100
PQDPALWVLH VLPNHSVGIS LGQGAEPGPG PGLGTAWLLG DNPPLHLRDL
110 120 130 140 150
SPYISFVSLE DGEEGEEEEE EDEEEEKRED GGAGSTEKVE PEEDRELAPT
160 170 180 190 200
SRESPQETNP PGESEEAARE AGGGKDGCRE DRVENETRPQ KRKGQRSEAA
210 220 230 240 250
PLHVSCLLLV TDEHGTILGI DLLVDGAQGT ASWGSGTKDL APWAYALLCH
260 270 280 290 300
SMACPMGSGD PRKPRQLTVG DARLHRELES LVPRLGVKLA KTPMRTWGPR
310 320 330 340 350
PGFTFASLRA RTCHVCHRHS FEAKLTPCPQ CSAVLYCGEA CLRADWQRCP
360 370 380 390 400
DDVSHRFWCP RLAAFMERAG ELATLPFTYT AEVTSETFNK EAFLASRGLT
410 420 430 440 450
RGYWTQLSML IPGPGFSRHP RGNTPSLSLL RGGDPYQLLQ GDGTALMPPV
460 470 480 490 500
PPHPPRGVFG SWQDYYTWRG LSLDSPIAVL LTYPLTVYYV ITHLVPQSFP
510 520 530 540 550
ELNIQNKQSL KIHVVEAGKE FDLVMVFWEL LVLLPHVALE LQFVGDGLPP
560 570 580 590 600
ESDEQHFTLQ RDSLEVSVRP GSGISARPSS GTKEKGGRRD LQIKVSARPY
610 620 630 640 650
HLFQGPKPDL VIGFNSGFAL KDTWLRSLPR LQSLRVPAFF TESSEYSCVM
660 670 680 690 700
DGQTMAVATG GGTSPPQPNP FRSPFRLRAA DNCMSWYCNA FIFHLVYKPA
710 720 730 740
QGSGARPAPG PPPPSPTPSA PPAPTRRRRG EKKPGRGARR RK
Length:742
Mass (Da):81,860
Last modified:January 25, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i88667EFB2B621CAF
GO
Isoform 2 (identifier: Q9H091-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     460-499: GSWQDYYTWRGLSLDSPIAVLLTYPLTVYYVITHLVPQSF → V

Show »
Length:703
Mass (Da):77,313
Checksum:i52ED9BF9113C1932
GO
Isoform 3 (identifier: Q9H091-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     612-612: I → IASPSSLSA

Note: No experimental confirmation available.
Show »
Length:750
Mass (Da):82,560
Checksum:i83126FA97C1E311B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052992401R → H. Corresponds to variant dbSNP:rs35005394Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042144460 – 499GSWQD…VPQSF → V in isoform 2. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_047208612I → IASPSSLSA in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK302181 mRNA Translation: BAG63547.1
AL136893 mRNA Translation: CAB66827.1
AC091153 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90414.1
BC067296 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11053.1 [Q9H091-2]
CCDS45584.1 [Q9H091-1]
CCDS58506.1 [Q9H091-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001129518.1, NM_001136046.2 [Q9H091-1]
NP_001254751.1, NM_001267822.1 [Q9H091-3]
NP_115641.1, NM_032265.2 [Q9H091-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000269289; ENSP00000269289; ENSG00000141497 [Q9H091-3]
ENST00000433935; ENSP00000391742; ENSG00000141497 [Q9H091-1]
ENST00000573751; ENSP00000459501; ENSG00000141497 [Q9H091-3]
ENST00000592813; ENSP00000465435; ENSG00000141497 [Q9H091-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84225

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84225

UCSC genome browser

More...
UCSCi
uc002fyt.4 human [Q9H091-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK302181 mRNA Translation: BAG63547.1
AL136893 mRNA Translation: CAB66827.1
AC091153 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90414.1
BC067296 mRNA No translation available.
CCDSiCCDS11053.1 [Q9H091-2]
CCDS45584.1 [Q9H091-1]
CCDS58506.1 [Q9H091-3]
RefSeqiNP_001129518.1, NM_001136046.2 [Q9H091-1]
NP_001254751.1, NM_001267822.1 [Q9H091-3]
NP_115641.1, NM_032265.2 [Q9H091-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000269289

PTM databases

iPTMnetiQ9H091
PhosphoSitePlusiQ9H091

Polymorphism and mutation databases

BioMutaiZMYND15
DMDMi374095468

Proteomic databases

MassIVEiQ9H091
PaxDbiQ9H091
PeptideAtlasiQ9H091
PRIDEiQ9H091
ProteomicsDBi46881
80218 [Q9H091-1]
80219 [Q9H091-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000269289; ENSP00000269289; ENSG00000141497 [Q9H091-3]
ENST00000433935; ENSP00000391742; ENSG00000141497 [Q9H091-1]
ENST00000573751; ENSP00000459501; ENSG00000141497 [Q9H091-3]
ENST00000592813; ENSP00000465435; ENSG00000141497 [Q9H091-2]
GeneIDi84225
KEGGihsa:84225
UCSCiuc002fyt.4 human [Q9H091-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84225
DisGeNETi84225

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZMYND15
HGNCiHGNC:20997 ZMYND15
HPAiHPA023286
MalaCardsiZMYND15
MIMi614312 gene
615842 phenotype
neXtProtiNX_Q9H091
OpenTargetsiENSG00000141497
Orphaneti399805 Male infertility with azoospermia or oligozoospermia due to single gene mutation
PharmGKBiPA134873463

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMI3 Eukaryota
ENOG4111I8B LUCA
GeneTreeiENSGT00390000000527
HOGENOMiHOG000231040
InParanoidiQ9H091
OMAiWWQLEAQ
OrthoDBi290771at2759
PhylomeDBiQ9H091
TreeFamiTF336410

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZMYND15 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84225

Pharos

More...
Pharosi
Q9H091

Protein Ontology

More...
PROi
PR:Q9H091

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000141497 Expressed in 96 organ(s), highest expression level in testis
GenevisibleiQ9H091 HS

Family and domain databases

InterProiView protein in InterPro
IPR002893 Znf_MYND
PfamiView protein in Pfam
PF01753 zf-MYND, 1 hit
PROSITEiView protein in PROSITE
PS50865 ZF_MYND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZMY15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H091
Secondary accession number(s): B4DXY5, I3L296
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2003
Last sequence update: January 25, 2012
Last modified: September 18, 2019
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again