Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9H013 (ADA19_HUMAN)

Entry version 186 (07 Oct 2020)
Sequence version 3 (10 Aug 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disintegrin and metalloproteinase domain-containing protein 19

Gene

ADAM19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the proteolytic processing of beta-type neuregulin isoforms which are involved in neurogenesis and synaptogenesis, suggesting a regulatory role in glial cell. Also cleaves alpha-2 macroglobulin. May be involved in osteoblast differentiation and/or osteoblast activity in bone (By similarity).By similarity

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi132Zinc; in inhibited formBy similarity1
Metal bindingi345Zinc; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei346PROSITE-ProRule annotation1
Metal bindingi349Zinc; catalyticBy similarity1
Metal bindingi355Zinc; catalyticBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9H013

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8941237, Invadopodia formation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		Q9H013

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9H013

Protein family/group databases

MEROPS protease database

More...MEROPSi		M12.214

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 19 (EC:3.4.24.-)
Short name:
ADAM 19
Alternative name(s):
Meltrin-beta
Metalloprotease and disintegrin dendritic antigen marker
Short name:
MADDAM
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAM19
Synonyms:MLTNB
ORF Names:FKSG34
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000135074.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:197, ADAM19

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603640, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9H013

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini203 – 699ExtracellularSequence analysisAdd BLAST497
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei700 – 720HelicalSequence analysisAdd BLAST21
Topological domaini721 – 955CytoplasmicSequence analysisAdd BLAST235

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8728

Open Targets

More...OpenTargetsi		ENSG00000135074

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24514

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9H013, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADAM19

Domain mapping of disease mutations (DMDM)

More...DMDMi		302393821

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000002910226 – 202By similarityAdd BLAST177
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000029103203 – 955Disintegrin and metalloproteinase domain-containing protein 19Add BLAST753

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi144N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi320 ↔ 403By similarity
Disulfide bondi360 ↔ 387By similarity
Disulfide bondi361 ↔ 370By similarity
Glycosylationi444N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi447N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi474 ↔ 494By similarity
Glycosylationi645N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi654 ↔ 664By similarity
Disulfide bondi658 ↔ 670By similarity
Disulfide bondi672 ↔ 681By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9H013

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9H013

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9H013

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9H013

PeptideAtlas

More...PeptideAtlasi		Q9H013

PRoteomics IDEntifications database

More...PRIDEi		Q9H013

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		80195 [Q9H013-1]
80196 [Q9H013-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9H013, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9H013

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9H013

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in many normal organ tissues and several cancer cell lines.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By 1,25(OH)2VD3 in monocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000135074, Expressed in blood and 222 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9H013, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9H013, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000135074, Tissue enhanced (lymphoid tissue, smooth muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SH3PXD2A.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114267, 3 interactors

Protein interaction database and analysis system

More...IntActi		Q9H013, 17 interactors

Molecular INTeraction database

More...MINTi		Q9H013

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000257527

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9H013, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9H013

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini210 – 408Peptidase M12BPROSITE-ProRule annotationAdd BLAST199
Domaini416 – 502DisintegrinPROSITE-ProRule annotationAdd BLAST87
Domaini650 – 682EGF-likePROSITE-ProRule annotationAdd BLAST33

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi130 – 137Cysteine switchBy similarity8
Motifi833 – 844SH3-bindingSequence analysisAdd BLAST12

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi434 – 437Poly-Glu4
Compositional biasi502 – 649Cys-richAdd BLAST148

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Keywords - Domaini

EGF-like domain, SH3-binding, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3607, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159624

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_012714_7_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9H013

KEGG Orthology (KO)

More...KOi		K08608

Identification of Orthologs from Complete Genome Data

More...OMAi		SYEITYP

Database of Orthologous Groups

More...OrthoDBi		162519at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9H013

TreeFam database of animal gene trees

More...TreeFami		TF314733

Family and domain databases

Conserved Domains Database

More...CDDi		cd04269, ZnMc_adamalysin_II_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.390.10, 1 hit
4.10.70.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR033596, ADAM19
IPR006586, ADAM_Cys-rich
IPR018358, Disintegrin_CS
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin

The PANTHER Classification System

More...PANTHERi		PTHR11905:SF19, PTHR11905:SF19, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00289, DISINTEGRIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57552, SSF57552, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS00427, DISINTEGRIN_1, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q9H013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGGAGAARL CLLAFALQPL RPRAAREPGW TRGSEEGSPK LQHELIIPQW 
        60         70         80         90        100
KTSESPVREK HPLKAELRVM AEGRELILDL EKNEQLFAPS YTETHYTSSG 
       110        120        130        140        150
NPQTTTRKLE DHCFYHGTVR ETELSSVTLS TCRGIRGLIT VSSNLSYVIE 
       160        170        180        190        200
PLPDSKGQHL IYRSEHLKPP PGNCGFEHSK PTTRDWALQF TQQTKKRPRR 
       210        220        230        240        250
MKREDLNSMK YVELYLVADY LEFQKNRRDQ DATKHKLIEI ANYVDKFYRS 
       260        270        280        290        300
LNIRIALVGL EVWTHGNMCE VSENPYSTLW SFLSWRRKLL AQKYHDNAQL 
       310        320        330        340        350
ITGMSFHGTT IGLAPLMAMC SVYQSGGVNM DHSENAIGVA ATMAHEMGHN 
       360        370        380        390        400
FGMTHDSADC CSASAADGGC IMAAATGHPF PKVFNGCNRR ELDRYLQSGG 
       410        420        430        440        450
GMCLSNMPDT RMLYGGRRCG NGYLEDGEEC DCGEEEECNN PCCNASNCTL 
       460        470        480        490        500
RPGAECAHGS CCHQCKLLAP GTLCREQARQ CDLPEFCTGK SPHCPTNFYQ 
       510        520        530        540        550
MDGTPCEGGQ AYCYNGMCLT YQEQCQQLWG PGARPAPDLC FEKVNVAGDT 
       560        570        580        590        600
FGNCGKDMNG EHRKCNMRDA KCGKIQCQSS EARPLESNAV PIDTTIIMNG 
       610        620        630        640        650
RQIQCRGTHV YRGPEEEGDM LDPGLVMTGT KCGYNHICFE GQCRNTSFFE 
       660        670        680        690        700
TEGCGKKCNG HGVCNNNQNC HCLPGWAPPF CNTPGHGGSI DSGPMPPESV 
       710        720        730        740        750
GPVVAGVLVA ILVLAVLMLM YYCCRQNNKL GQLKPSALPS KLRQQFSCPF 
       760        770        780        790        800
RVSQNSGTGH ANPTFKLQTP QGKRKVINTP EILRKPSQPP PRPPPDYLRG 
       810        820        830        840        850
GSPPAPLPAH LSRAARNSPG PGSQIERTES SRRPPPSRPI PPAPNCIVSQ 
       860        870        880        890        900
DFSRPRPPQK ALPANPVPGR RSLPRPGGAS PLRPPGAGPQ QSRPLAALAP 
       910        920        930        940        950
KVSPREALKV KAGTRGLQGG RCRVEKTKQF MLLVVWTELP EQKPRAKHSC 

FLVPA
Length:955
Mass (Da):104,997
Last modified:August 10, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9C9D42BED18BF7F9
GO
Isoform B (identifier: Q9H013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     902-955: VSPREALKVKAGTRGLQGGRCRVEKTKQFMLLVVWTELPEQKPRAKHSCFLVPA → FPEYRSQRAGGMISSKI

Show »
Length:918
Mass (Da):100,848
Checksum:i048EA0189D3D126A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YC66H0YC66_HUMAN
Disintegrin and metalloproteinase d...
ADAM19
489Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIS2E5RIS2_HUMAN
Disintegrin and metalloproteinase d...
ADAM19
272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32R → SK in AAG50282 (Ref. 1) Curated1
Sequence conflicti557D → V in AAG50282 (Ref. 1) Curated1
Sequence conflicti557D → V in AAF22162 (Ref. 5) Curated1
Sequence conflicti622D → N in AAG50282 (Ref. 1) Curated1
Sequence conflicti622D → N in AAF22162 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0570664G → S1 PublicationCorresponds to variant dbSNP:rs11465228Ensembl.1
Natural variantiVAR_036146133R → Q in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs200894535Ensembl.1
Natural variantiVAR_036147298A → T in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1178207005Ensembl.1
Natural variantiVAR_062670609H → Q in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005481902 – 955VSPRE…FLVPA → FPEYRSQRAGGMISSKI in isoform B. 2 PublicationsAdd BLAST54

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF326918 mRNA Translation: AAG50282.1
Y13786 mRNA Translation: CAC20585.1
AF311317 mRNA Translation: AAK07852.1
AC008676 Genomic DNA No translation available.
AC008694 Genomic DNA No translation available.
AC106801 Genomic DNA No translation available.
AF134707 mRNA Translation: AAF22162.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4338.1 [Q9H013-2]

NCBI Reference Sequences

More...RefSeqi		NP_150377.1, NM_033274.4 [Q9H013-2]
XP_005266060.1, XM_005266003.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000257527; ENSP00000257527; ENSG00000135074 [Q9H013-2]
ENST00000517905; ENSP00000428654; ENSG00000135074 [Q9H013-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8728

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8728

UCSC genome browser

More...UCSCi		uc003lwz.5, human [Q9H013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF326918 mRNA Translation: AAG50282.1
Y13786 mRNA Translation: CAC20585.1
AF311317 mRNA Translation: AAK07852.1
AC008676 Genomic DNA No translation available.
AC008694 Genomic DNA No translation available.
AC106801 Genomic DNA No translation available.
AF134707 mRNA Translation: AAF22162.1
CCDSiCCDS4338.1 [Q9H013-2]
RefSeqiNP_150377.1, NM_033274.4 [Q9H013-2]
XP_005266060.1, XM_005266003.2

3D structure databases

SMRiQ9H013
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114267, 3 interactors
IntActiQ9H013, 17 interactors
MINTiQ9H013
STRINGi9606.ENSP00000257527

Protein family/group databases

MEROPSiM12.214

PTM databases

GlyGeniQ9H013, 4 sites
iPTMnetiQ9H013
PhosphoSitePlusiQ9H013

Polymorphism and mutation databases

BioMutaiADAM19
DMDMi302393821

Proteomic databases

jPOSTiQ9H013
MassIVEiQ9H013
MaxQBiQ9H013
PaxDbiQ9H013
PeptideAtlasiQ9H013
PRIDEiQ9H013
ProteomicsDBi80195 [Q9H013-1]
80196 [Q9H013-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		16547, 249 antibodies

The DNASU plasmid repository

More...DNASUi		8728

Genome annotation databases

EnsembliENST00000257527; ENSP00000257527; ENSG00000135074 [Q9H013-2]
ENST00000517905; ENSP00000428654; ENSG00000135074 [Q9H013-1]
GeneIDi8728
KEGGihsa:8728
UCSCiuc003lwz.5, human [Q9H013-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8728
DisGeNETi8728
EuPathDBiHostDB:ENSG00000135074.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADAM19
HGNCiHGNC:197, ADAM19
HPAiENSG00000135074, Tissue enhanced (lymphoid tissue, smooth muscle)
MIMi603640, gene
neXtProtiNX_Q9H013
OpenTargetsiENSG00000135074
PharmGKBiPA24514

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3607, Eukaryota
GeneTreeiENSGT00940000159624
HOGENOMiCLU_012714_7_0_1
InParanoidiQ9H013
KOiK08608
OMAiSYEITYP
OrthoDBi162519at2759
PhylomeDBiQ9H013
TreeFamiTF314733

Enzyme and pathway databases

PathwayCommonsiQ9H013
ReactomeiR-HSA-8941237, Invadopodia formation
SABIO-RKiQ9H013
SIGNORiQ9H013

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8728, 1 hit in 869 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADAM19, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADAM19

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8728
PharosiQ9H013, Tbio

Protein Ontology

More...PROi		PR:Q9H013
RNActiQ9H013, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000135074, Expressed in blood and 222 other tissues
ExpressionAtlasiQ9H013, baseline and differential
GenevisibleiQ9H013, HS

Family and domain databases

CDDicd04269, ZnMc_adamalysin_II_like, 1 hit
Gene3Di3.40.390.10, 1 hit
4.10.70.10, 1 hit
InterProiView protein in InterPro
IPR033596, ADAM19
IPR006586, ADAM_Cys-rich
IPR018358, Disintegrin_CS
IPR001762, Disintegrin_dom
IPR036436, Disintegrin_dom_sf
IPR000742, EGF-like_dom
IPR024079, MetalloPept_cat_dom_sf
IPR001590, Peptidase_M12B
IPR002870, Peptidase_M12B_N
IPR034027, Reprolysin_adamalysin
PANTHERiPTHR11905:SF19, PTHR11905:SF19, 1 hit
PfamiView protein in Pfam
PF08516, ADAM_CR, 1 hit
PF00200, Disintegrin, 1 hit
PF01562, Pep_M12B_propep, 1 hit
PF01421, Reprolysin, 1 hit
PRINTSiPR00289, DISINTEGRIN
SMARTiView protein in SMART
SM00608, ACR, 1 hit
SM00050, DISIN, 1 hit
SUPFAMiSSF57552, SSF57552, 1 hit
PROSITEiView protein in PROSITE
PS50215, ADAM_MEPRO, 1 hit
PS00427, DISINTEGRIN_1, 1 hit
PS50214, DISINTEGRIN_2, 1 hit
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA19_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9H013
Secondary accession number(s): Q9BZL5, Q9UHP2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: August 10, 2010
Last modified: October 7, 2020
This is version 186 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again