Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9GZT6 (CC90B_HUMAN)

Entry version 123 (18 Sep 2019)
Sequence version 2 (20 Apr 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Coiled-coil domain-containing protein 90B, mitochondrial

Gene

CCDC90B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 90B, mitochondrial
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC90B
ORF Names:CUA003, MDS011, MDS025
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28108 CCDC90B

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9GZT6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei231 – 253HelicalSequence analysisAdd BLAST23

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000137500

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162381967

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9GZT6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCDC90B

Domain mapping of disease mutations (DMDM)

More...DMDMi		294862420

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 42MitochondrionSequence analysisAdd BLAST42
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029569543 – 254Coiled-coil domain-containing protein 90B, mitochondrialAdd BLAST212

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9GZT6

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9GZT6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9GZT6

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9GZT6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9GZT6

PeptideAtlas

More...PeptideAtlasi		Q9GZT6

PRoteomics IDEntifications database

More...PRIDEi		Q9GZT6

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		3524
80133 [Q9GZT6-1]
80134 [Q9GZT6-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q9GZT6-1 [Q9GZT6-1]
Q9GZT6-2 [Q9GZT6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9GZT6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9GZT6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000137500 Expressed in 224 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9GZT6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9GZT6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA011130
HPA011931

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MCU (PubMed:27184846).

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		121923, 31 interactors

Protein interaction database and analysis system

More...IntActi		Q9GZT6, 37 interactors

Molecular INTeraction database

More...MINTi		Q9GZT6

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000434724

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1254
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9GZT6

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili129 – 164Sequence analysisAdd BLAST36

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCDC90 family.Curated

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3156 Eukaryota
ENOG4111F9W LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155453

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000294135

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9GZT6

Identification of Orthologs from Complete Genome Data

More...OMAi		TAMAEVI

Database of Orthologous Groups

More...OrthoDBi		1252164at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9GZT6

TreeFam database of animal gene trees

More...TreeFami		TF331442

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR024461 DUF1640

The PANTHER Classification System

More...PANTHERi		PTHR14360 PTHR14360, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07798 DUF1640, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9GZT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSRQAWRLF LSQGRGDRWV SRPRGHFSPA LRREFFTTTT KEGYDRRPVD 
        60         70         80         90        100
ITPLEQRKLT FDTHALVQDL ETHGFDKTQA ETIVSALTAL SNVSLDTIYK 
       110        120        130        140        150
EMVTQAQQEI TVQQLMAHLD AIRKDMVILE KSEFANLRAE NEKMKIELDQ 
       160        170        180        190        200
VKQQLMHETS RIRADNKLDI NLERSRVTDM FTDQEKQLME TTTEFTKKDT 
       210        220        230        240        250
QTKSIISETS NKIDAEIASL KTLMESNKLE TIRYLAASVF TCLAIALGFY 

RFWK
Length:254
Mass (Da):29,506
Last modified:April 20, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i773DB2E66AB6C921
GO
Isoform 2 (identifier: Q9GZT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRR → MLANCGSVCEETQFRGTTVAPALG

Show »
Length:245
Mass (Da):27,979
Checksum:iF24AE980B00734B4
GO
Isoform 3 (identifier: Q9GZT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-101: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):17,812
Checksum:iECAB99D950D543D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PKQ5E9PKQ5_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KN19J3KN19_HUMAN
Coiled-coil domain-containing prote...
CCDC90B MDS025, hCG_27349
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMQ7E9PMQ7_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YF06H0YF06_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRC2E9PRC2_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD95H0YD95_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPJ7E9PPJ7_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNI8E9PNI8_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSG6E9PSG6_HUMAN
Coiled-coil domain-containing prote...
CCDC90B
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03332210F → L2 PublicationsCorresponds to variant dbSNP:rs494791Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0556631 – 101Missing in isoform 3. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_0270031 – 33MNSRQ…PALRR → MLANCGSVCEETQFRGTTVA PALG in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL136791 mRNA Translation: CAB66725.1
AF182412 mRNA Translation: AAG14948.1
AF182424 mRNA Translation: AAG14960.1
AF271782 mRNA Translation: AAG44793.1
AK055972 mRNA Translation: BAG51599.1
AK292349 mRNA Translation: BAF85038.1
AK304769 mRNA Translation: BAG65524.1
AP000873 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75089.1
CH471076 Genomic DNA Translation: EAW75091.1
BC014573 mRNA Translation: AAH14573.1
BC020783 mRNA Translation: AAH20783.1
BC107755 mRNA Translation: AAI07756.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS66190.1 [Q9GZT6-3]
CCDS66191.1 [Q9GZT6-2]
CCDS8266.1 [Q9GZT6-1]

NCBI Reference Sequences

More...RefSeqi		NP_001273045.1, NM_001286116.1 [Q9GZT6-2]
NP_001273046.1, NM_001286117.1 [Q9GZT6-3]
NP_001273047.1, NM_001286118.1
NP_001273048.1, NM_001286119.1
NP_001273049.1, NM_001286120.1
NP_068597.2, NM_021825.4 [Q9GZT6-1]
XP_005274216.1, XM_005274159.3 [Q9GZT6-3]
XP_016873593.1, XM_017018104.1 [Q9GZT6-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000455220; ENSP00000390990; ENSG00000137500 [Q9GZT6-2]
ENST00000525503; ENSP00000431424; ENSG00000137500 [Q9GZT6-3]
ENST00000529611; ENSP00000431345; ENSG00000137500 [Q9GZT6-3]
ENST00000529689; ENSP00000434724; ENSG00000137500 [Q9GZT6-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		60492

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:60492

UCSC genome browser

More...UCSCi		uc001pac.5 human [Q9GZT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136791 mRNA Translation: CAB66725.1
AF182412 mRNA Translation: AAG14948.1
AF182424 mRNA Translation: AAG14960.1
AF271782 mRNA Translation: AAG44793.1
AK055972 mRNA Translation: BAG51599.1
AK292349 mRNA Translation: BAF85038.1
AK304769 mRNA Translation: BAG65524.1
AP000873 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75089.1
CH471076 Genomic DNA Translation: EAW75091.1
BC014573 mRNA Translation: AAH14573.1
BC020783 mRNA Translation: AAH20783.1
BC107755 mRNA Translation: AAI07756.1
CCDSiCCDS66190.1 [Q9GZT6-3]
CCDS66191.1 [Q9GZT6-2]
CCDS8266.1 [Q9GZT6-1]
RefSeqiNP_001273045.1, NM_001286116.1 [Q9GZT6-2]
NP_001273046.1, NM_001286117.1 [Q9GZT6-3]
NP_001273047.1, NM_001286118.1
NP_001273048.1, NM_001286119.1
NP_001273049.1, NM_001286120.1
NP_068597.2, NM_021825.4 [Q9GZT6-1]
XP_005274216.1, XM_005274159.3 [Q9GZT6-3]
XP_016873593.1, XM_017018104.1 [Q9GZT6-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6H9MX-ray2.10A/B/C43-126[»]
SMRiQ9GZT6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi121923, 31 interactors
IntActiQ9GZT6, 37 interactors
MINTiQ9GZT6
STRINGi9606.ENSP00000434724

PTM databases

iPTMnetiQ9GZT6
PhosphoSitePlusiQ9GZT6

Polymorphism and mutation databases

BioMutaiCCDC90B
DMDMi294862420

Proteomic databases

EPDiQ9GZT6
jPOSTiQ9GZT6
MassIVEiQ9GZT6
MaxQBiQ9GZT6
PaxDbiQ9GZT6
PeptideAtlasiQ9GZT6
PRIDEiQ9GZT6
ProteomicsDBi3524
80133 [Q9GZT6-1]
80134 [Q9GZT6-2]
TopDownProteomicsiQ9GZT6-1 [Q9GZT6-1]
Q9GZT6-2 [Q9GZT6-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		60492

Genome annotation databases

EnsembliENST00000455220; ENSP00000390990; ENSG00000137500 [Q9GZT6-2]
ENST00000525503; ENSP00000431424; ENSG00000137500 [Q9GZT6-3]
ENST00000529611; ENSP00000431345; ENSG00000137500 [Q9GZT6-3]
ENST00000529689; ENSP00000434724; ENSG00000137500 [Q9GZT6-1]
GeneIDi60492
KEGGihsa:60492
UCSCiuc001pac.5 human [Q9GZT6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		60492

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCDC90B
HGNCiHGNC:28108 CCDC90B
HPAiHPA011130
HPA011931
neXtProtiNX_Q9GZT6
OpenTargetsiENSG00000137500
PharmGKBiPA162381967

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3156 Eukaryota
ENOG4111F9W LUCA
GeneTreeiENSGT00940000155453
HOGENOMiHOG000294135
InParanoidiQ9GZT6
OMAiTAMAEVI
OrthoDBi1252164at2759
PhylomeDBiQ9GZT6
TreeFamiTF331442

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCDC90B human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CCDC90B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		60492
PharosiQ9GZT6

Protein Ontology

More...PROi		PR:Q9GZT6

Gene expression databases

BgeeiENSG00000137500 Expressed in 224 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ9GZT6 baseline and differential
GenevisibleiQ9GZT6 HS

Family and domain databases

InterProiView protein in InterPro
IPR024461 DUF1640
PANTHERiPTHR14360 PTHR14360, 1 hit
PfamiView protein in Pfam
PF07798 DUF1640, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC90B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9GZT6
Secondary accession number(s): A8K8I4
, B3KP87, B4E3L2, Q3B781, Q9GZU6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: April 20, 2010
Last modified: September 18, 2019
This is version 123 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again