Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 90B, mitochondrial

Gene

CCDC90B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 90B, mitochondrial
Gene namesi
Name:CCDC90B
ORF Names:CUA003, MDS011, MDS025
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000137500.9
HGNCiHGNC:28108 CCDC90B
neXtProtiNX_Q9GZT6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei231 – 253HelicalSequence analysisAdd BLAST23

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000137500
PharmGKBiPA162381967

Polymorphism and mutation databases

BioMutaiCCDC90B
DMDMi294862420

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 42MitochondrionSequence analysisAdd BLAST42
ChainiPRO_000029569543 – 254Coiled-coil domain-containing protein 90B, mitochondrialAdd BLAST212

Proteomic databases

EPDiQ9GZT6
MaxQBiQ9GZT6
PaxDbiQ9GZT6
PeptideAtlasiQ9GZT6
PRIDEiQ9GZT6
ProteomicsDBi80133
80134 [Q9GZT6-2]
TopDownProteomicsiQ9GZT6-1 [Q9GZT6-1]
Q9GZT6-2 [Q9GZT6-2]

PTM databases

iPTMnetiQ9GZT6
PhosphoSitePlusiQ9GZT6

Expressioni

Gene expression databases

BgeeiENSG00000137500
CleanExiHS_CCDC90B
ExpressionAtlasiQ9GZT6 baseline and differential
GenevisibleiQ9GZT6 HS

Organism-specific databases

HPAiHPA011130
HPA011931

Interactioni

Subunit structurei

Interacts with MCU (PubMed:27184846).1 Publication

Protein-protein interaction databases

BioGridi121923, 31 interactors
IntActiQ9GZT6, 33 interactors
MINTiQ9GZT6
STRINGi9606.ENSP00000434724

Structurei

3D structure databases

ProteinModelPortaliQ9GZT6
SMRiQ9GZT6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili129 – 164Sequence analysisAdd BLAST36

Sequence similaritiesi

Belongs to the CCDC90 family.Curated

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3156 Eukaryota
ENOG4111F9W LUCA
GeneTreeiENSGT00390000016409
HOGENOMiHOG000294135
HOVERGENiHBG107611
InParanoidiQ9GZT6
OMAiKEGYDMR
OrthoDBiEOG091G0955
PhylomeDBiQ9GZT6
TreeFamiTF331442

Family and domain databases

InterProiView protein in InterPro
IPR024461 DUF1640
PANTHERiPTHR14360 PTHR14360, 1 hit
PfamiView protein in Pfam
PF07798 DUF1640, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9GZT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNSRQAWRLF LSQGRGDRWV SRPRGHFSPA LRREFFTTTT KEGYDRRPVD
60 70 80 90 100
ITPLEQRKLT FDTHALVQDL ETHGFDKTQA ETIVSALTAL SNVSLDTIYK
110 120 130 140 150
EMVTQAQQEI TVQQLMAHLD AIRKDMVILE KSEFANLRAE NEKMKIELDQ
160 170 180 190 200
VKQQLMHETS RIRADNKLDI NLERSRVTDM FTDQEKQLME TTTEFTKKDT
210 220 230 240 250
QTKSIISETS NKIDAEIASL KTLMESNKLE TIRYLAASVF TCLAIALGFY

RFWK
Length:254
Mass (Da):29,506
Last modified:April 20, 2010 - v2
Checksum:i773DB2E66AB6C921
GO
Isoform 2 (identifier: Q9GZT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRR → MLANCGSVCEETQFRGTTVAPALG

Show »
Length:245
Mass (Da):27,979
Checksum:iF24AE980B00734B4
GO
Isoform 3 (identifier: Q9GZT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-101: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):17,812
Checksum:iECAB99D950D543D8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03332210F → L2 PublicationsCorresponds to variant dbSNP:rs494791Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0556631 – 101Missing in isoform 3. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_0270031 – 33MNSRQ…PALRR → MLANCGSVCEETQFRGTTVA PALG in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136791 mRNA Translation: CAB66725.1
AF182412 mRNA Translation: AAG14948.1
AF182424 mRNA Translation: AAG14960.1
AF271782 mRNA Translation: AAG44793.1
AK055972 mRNA Translation: BAG51599.1
AK292349 mRNA Translation: BAF85038.1
AK304769 mRNA Translation: BAG65524.1
AP000873 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW75089.1
CH471076 Genomic DNA Translation: EAW75091.1
BC014573 mRNA Translation: AAH14573.1
BC020783 mRNA Translation: AAH20783.1
BC107755 mRNA Translation: AAI07756.1
CCDSiCCDS66190.1 [Q9GZT6-3]
CCDS66191.1 [Q9GZT6-2]
CCDS8266.1 [Q9GZT6-1]
RefSeqiNP_001273045.1, NM_001286116.1 [Q9GZT6-2]
NP_001273046.1, NM_001286117.1 [Q9GZT6-3]
NP_001273047.1, NM_001286118.1
NP_001273048.1, NM_001286119.1
NP_001273049.1, NM_001286120.1
NP_068597.2, NM_021825.4 [Q9GZT6-1]
XP_005274216.1, XM_005274159.3 [Q9GZT6-3]
XP_016873593.1, XM_017018104.1 [Q9GZT6-3]
UniGeneiHs.368866

Genome annotation databases

EnsembliENST00000455220; ENSP00000390990; ENSG00000137500 [Q9GZT6-2]
ENST00000525503; ENSP00000431424; ENSG00000137500 [Q9GZT6-3]
ENST00000529611; ENSP00000431345; ENSG00000137500 [Q9GZT6-3]
ENST00000529689; ENSP00000434724; ENSG00000137500 [Q9GZT6-1]
GeneIDi60492
KEGGihsa:60492
UCSCiuc001pac.5 human [Q9GZT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCC90B_HUMAN
AccessioniPrimary (citable) accession number: Q9GZT6
Secondary accession number(s): A8K8I4
, B3KP87, B4E3L2, Q3B781, Q9GZU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: April 20, 2010
Last modified: June 20, 2018
This is version 113 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health