Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (17 Jun 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tubulointerstitial nephritis antigen-like

Gene

TINAGL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • endosomal transport Source: UniProtKB
  • proteolysis Source: GOC

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C01.975

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulointerstitial nephritis antigen-like
Alternative name(s):
Glucocorticoid-inducible protein 5
Oxidized LDL-responsive gene 2 protein
Short name:
OLRG-2
Tubulointerstitial nephritis antigen-related protein
Short name:
TIN Ag-related protein
Short name:
TIN-Ag-RP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TINAGL1
Synonyms:GIS5, LCN7, OLRG2, TINAGL
ORF Names:PP6614, PSEC0088, UNQ204/PRO230
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000142910.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19168 TINAGL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616064 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9GZM7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
64129

Open Targets

More...
OpenTargetsi
ENSG00000142910

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38810

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9GZM7 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TINAGL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
61213628

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 212 PublicationsAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002648222 – 467Tubulointerstitial nephritis antigen-likeAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi54 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 85AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi77 ↔ 84PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi78N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi85 ↔ 92AlternatePROSITE-ProRule annotation
Glycosylationi161N-linked (GlcNAc...) asparagine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9GZM7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9GZM7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9GZM7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9GZM7

PeptideAtlas

More...
PeptideAtlasi
Q9GZM7

PRoteomics IDEntifications database

More...
PRIDEi
Q9GZM7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80089 [Q9GZM7-1]
80090 [Q9GZM7-2]
80091 [Q9GZM7-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1864

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9GZM7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9GZM7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000142910 Expressed in adult mammalian kidney and 170 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9GZM7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9GZM7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000142910 Tissue enhanced (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122078, 22 interactors

Protein interaction database and analysis system

More...
IntActi
Q9GZM7, 66 interactors

Molecular INTeraction database

More...
MINTi
Q9GZM7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000271064

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9GZM7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 98SMBPROSITE-ProRule annotationAdd BLAST49

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1544 Eukaryota
ENOG410YN9K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160023

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9GZM7

Identification of Orthologs from Complete Genome Data

More...
OMAi
EVPDQGW

Database of Orthologous Groups

More...
OrthoDBi
1436535at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9GZM7

TreeFam database of animal gene trees

More...
TreeFami
TF313765

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038765 Papain-like_cys_pep_sf
IPR025660 Pept_his_AS
IPR000668 Peptidase_C1A_C
IPR001212 Somatomedin_B_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00112 Peptidase_C1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00645 Pept_C1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54001 SSF54001, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00524 SMB_1, 1 hit
PS50958 SMB_2, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9GZM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE
60 70 80 90 100
QDLCCRGRAD DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP
110 120 130 140 150
PIQGCMHGGR IYPVLGTYWD NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI
160 170 180 190 200
NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT IRPSSSVMNM HEIYTVLNPG
210 220 230 240 250
EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD RVSIHSLGHM
260 270 280 290 300
TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER
310 320 330 340 350
DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND
360 370 380 390 400
KEIMKELMEN GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH
410 420 430 440 450
SVKITGWGEE TLPDGRTLKY WTAANSWGPA WGERGHFRIV RGVNECDIES
460
FVLGVWGRVG MEDMGHH
Length:467
Mass (Da):52,387
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE9D72220E3E7B7D5
GO
Isoform 2 (identifier: Q9GZM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
     286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
     365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
     382-467: Missing.

Show »
Length:284
Mass (Da):30,845
Checksum:iE389D4425C84FB08
GO
Isoform 3 (identifier: Q9GZM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-156: Missing.

Show »
Length:436
Mass (Da):48,807
Checksum:iE66031AF51808DCD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6SDV2F6SDV2_HUMAN
Tubulointerstitial nephritis antige...
TINAGL1 hCG_41620
362Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH09048 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55403 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti333N → Y in AAL55753 (PubMed:15498874).Curated1
Sequence conflicti377K → E in BAB55403 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05151469A → S. Corresponds to variant dbSNP:rs17497479Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0130941 – 134Missing in isoform 2. 2 PublicationsAdd BLAST134
Alternative sequenceiVSP_043712126 – 156Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013095135 – 194CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_013096286G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. 2 Publications1
Alternative sequenceiVSP_013097365 – 381ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_013098382 – 467Missing in isoform 2. 2 PublicationsAdd BLAST86

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF236155 AF236154 Genomic DNA Translation: AAG40154.1
AF236150 mRNA Translation: AAG38876.1
AF205436 mRNA Translation: AAG33699.1
AB050716 mRNA Translation: BAB18636.1
AB050719 Genomic DNA Translation: BAB18727.1
AK074124 mRNA Translation: BAB84950.1
AY358421 mRNA Translation: AAQ88787.1
AF289569 mRNA Translation: AAL55753.1
AK027839 mRNA Translation: BAB55403.1 Different initiation.
AK292770 mRNA Translation: BAF85459.1
AK298382 mRNA Translation: BAG60618.1
AK075398 mRNA Translation: BAC11596.1
AC114488 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07604.1
CH471059 Genomic DNA Translation: EAX07605.1
CH471059 Genomic DNA Translation: EAX07606.1
BC009048 mRNA Translation: AAH09048.1 Different initiation.
BC064633 mRNA Translation: AAH64633.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS343.1 [Q9GZM7-1]
CCDS55586.1 [Q9GZM7-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001191343.1, NM_001204414.1 [Q9GZM7-3]
NP_001191344.1, NM_001204415.1
NP_071447.1, NM_022164.2 [Q9GZM7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000271064; ENSP00000271064; ENSG00000142910 [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910 [Q9GZM7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64129

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64129

UCSC genome browser

More...
UCSCi
uc001bta.4 human [Q9GZM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155 AF236154 Genomic DNA Translation: AAG40154.1
AF236150 mRNA Translation: AAG38876.1
AF205436 mRNA Translation: AAG33699.1
AB050716 mRNA Translation: BAB18636.1
AB050719 Genomic DNA Translation: BAB18727.1
AK074124 mRNA Translation: BAB84950.1
AY358421 mRNA Translation: AAQ88787.1
AF289569 mRNA Translation: AAL55753.1
AK027839 mRNA Translation: BAB55403.1 Different initiation.
AK292770 mRNA Translation: BAF85459.1
AK298382 mRNA Translation: BAG60618.1
AK075398 mRNA Translation: BAC11596.1
AC114488 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07604.1
CH471059 Genomic DNA Translation: EAX07605.1
CH471059 Genomic DNA Translation: EAX07606.1
BC009048 mRNA Translation: AAH09048.1 Different initiation.
BC064633 mRNA Translation: AAH64633.1
CCDSiCCDS343.1 [Q9GZM7-1]
CCDS55586.1 [Q9GZM7-3]
RefSeqiNP_001191343.1, NM_001204414.1 [Q9GZM7-3]
NP_001191344.1, NM_001204415.1
NP_071447.1, NM_022164.2 [Q9GZM7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi122078, 22 interactors
IntActiQ9GZM7, 66 interactors
MINTiQ9GZM7
STRINGi9606.ENSP00000271064

Protein family/group databases

MEROPSiC01.975

PTM databases

GlyConnecti1864
iPTMnetiQ9GZM7
PhosphoSitePlusiQ9GZM7

Polymorphism and mutation databases

BioMutaiTINAGL1
DMDMi61213628

Proteomic databases

jPOSTiQ9GZM7
MassIVEiQ9GZM7
MaxQBiQ9GZM7
PaxDbiQ9GZM7
PeptideAtlasiQ9GZM7
PRIDEiQ9GZM7
ProteomicsDBi80089 [Q9GZM7-1]
80090 [Q9GZM7-2]
80091 [Q9GZM7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31121 180 antibodies

Genome annotation databases

EnsembliENST00000271064; ENSP00000271064; ENSG00000142910 [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910 [Q9GZM7-3]
GeneIDi64129
KEGGihsa:64129
UCSCiuc001bta.4 human [Q9GZM7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64129
DisGeNETi64129
EuPathDBiHostDB:ENSG00000142910.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TINAGL1
HGNCiHGNC:19168 TINAGL1
HPAiENSG00000142910 Tissue enhanced (placenta)
MIMi616064 gene
neXtProtiNX_Q9GZM7
OpenTargetsiENSG00000142910
PharmGKBiPA38810

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1544 Eukaryota
ENOG410YN9K LUCA
GeneTreeiENSGT00940000160023
InParanoidiQ9GZM7
OMAiEVPDQGW
OrthoDBi1436535at2759
PhylomeDBiQ9GZM7
TreeFamiTF313765

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
64129 0 hits in 784 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TINAGL1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TINAGL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64129
PharosiQ9GZM7 Tbio

Protein Ontology

More...
PROi
PR:Q9GZM7
RNActiQ9GZM7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000142910 Expressed in adult mammalian kidney and 170 other tissues
ExpressionAtlasiQ9GZM7 baseline and differential
GenevisibleiQ9GZM7 HS

Family and domain databases

InterProiView protein in InterPro
IPR038765 Papain-like_cys_pep_sf
IPR025660 Pept_his_AS
IPR000668 Peptidase_C1A_C
IPR001212 Somatomedin_B_dom
PfamiView protein in Pfam
PF00112 Peptidase_C1, 1 hit
SMARTiView protein in SMART
SM00645 Pept_C1, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS00524 SMB_1, 1 hit
PS50958 SMB_2, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTINAL_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9GZM7
Secondary accession number(s): A8K9Q5
, B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 1, 2001
Last modified: June 17, 2020
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again