Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulointerstitial nephritis antigen-like

Gene

TINAGL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • endosomal transport Source: UniProtKB
  • immune response Source: InterPro

Protein family/group databases

MEROPSiC01.975

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulointerstitial nephritis antigen-like
Alternative name(s):
Glucocorticoid-inducible protein 5
Oxidized LDL-responsive gene 2 protein
Short name:
OLRG-2
Tubulointerstitial nephritis antigen-related protein
Short name:
TIN Ag-related protein
Short name:
TIN-Ag-RP
Gene namesi
Name:TINAGL1
Synonyms:GIS5, LCN7, OLRG2, TINAGL
ORF Names:PP6614, PSEC0088, UNQ204/PRO230
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000142910.15
HGNCiHGNC:19168 TINAGL1
MIMi616064 gene
neXtProtiNX_Q9GZM7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi64129
OpenTargetsiENSG00000142910
PharmGKBiPA38810

Polymorphism and mutation databases

BioMutaiTINAGL1
DMDMi61213628

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 212 PublicationsAdd BLAST21
ChainiPRO_000002648222 – 467Tubulointerstitial nephritis antigen-likeAdd BLAST446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi54 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 85AlternatePROSITE-ProRule annotation
Disulfide bondi71 ↔ 73AlternatePROSITE-ProRule annotation
Disulfide bondi77 ↔ 84PROSITE-ProRule annotation
Glycosylationi78N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi85 ↔ 92AlternatePROSITE-ProRule annotation
Glycosylationi161N-linked (GlcNAc...) asparagine1 Publication1

Post-translational modificationi

Glycosylated.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9GZM7
PaxDbiQ9GZM7
PeptideAtlasiQ9GZM7
PRIDEiQ9GZM7
ProteomicsDBi80089
80090 [Q9GZM7-2]
80091 [Q9GZM7-3]

PTM databases

GlyConnecti1864
iPTMnetiQ9GZM7
PhosphoSitePlusiQ9GZM7

Expressioni

Tissue specificityi

Highly expressed in aorta, heart, placenta, kidney and a colorectal adenocarcinoma cell line. Moderately expressed in skeletal muscle, pancreas, lung, lymph nodes, adrenal gland, bone marrow and thyroid. Weakly expressed in colon, small intestine, ovary, spleen, testis and prostate. Predominantly found in vascular smooth muscle cells, but also in cardiac and skeletal muscle cells as well as kidney.1 Publication

Gene expression databases

BgeeiENSG00000142910 Expressed in 171 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_TINAGL1
ExpressionAtlasiQ9GZM7 baseline and differential
GenevisibleiQ9GZM7 HS

Organism-specific databases

HPAiHPA048695

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122078, 21 interactors
IntActiQ9GZM7, 60 interactors
MINTiQ9GZM7
STRINGi9606.ENSP00000271064

Structurei

3D structure databases

ProteinModelPortaliQ9GZM7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini50 – 98SMBPROSITE-ProRule annotationAdd BLAST49

Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1544 Eukaryota
ENOG410YN9K LUCA
GeneTreeiENSGT00900000140859
HOGENOMiHOG000241342
HOVERGENiHBG053961
InParanoidiQ9GZM7
OMAiKYWIAAN
OrthoDBiEOG091G0A2N
PhylomeDBiQ9GZM7
TreeFamiTF313765

Family and domain databases

InterProiView protein in InterPro
IPR038765 Papain_like_cys_pep_sf
IPR025660 Pept_his_AS
IPR013128 Peptidase_C1A
IPR000668 Peptidase_C1A_C
IPR001212 Somatomedin_B_dom
PANTHERiPTHR12411 PTHR12411, 1 hit
PfamiView protein in Pfam
PF00112 Peptidase_C1, 1 hit
SMARTiView protein in SMART
SM00645 Pept_C1, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS00524 SMB_1, 1 hit
PS50958 SMB_2, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9GZM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWRCPLGLLL LLPLAGHLAL GAQQGRGRRE LAPGLHLRGI RDAGGRYCQE
60 70 80 90 100
QDLCCRGRAD DCALPYLGAI CYCDLFCNRT VSDCCPDFWD FCLGVPPPFP
110 120 130 140 150
PIQGCMHGGR IYPVLGTYWD NCNRCTCQEN RQWQCDQEPC LVDPDMIKAI
160 170 180 190 200
NQGNYGWQAG NHSAFWGMTL DEGIRYRLGT IRPSSSVMNM HEIYTVLNPG
210 220 230 240 250
EVLPTAFEAS EKWPNLIHEP LDQGNCAGSW AFSTAAVASD RVSIHSLGHM
260 270 280 290 300
TPVLSPQNLL SCDTHQQQGC RGGRLDGAWW FLRRRGVVSD HCYPFSGRER
310 320 330 340 350
DEAGPAPPCM MHSRAMGRGK RQATAHCPNS YVNNNDIYQV TPVYRLGSND
360 370 380 390 400
KEIMKELMEN GPVQALMEVH EDFFLYKGGI YSHTPVSLGR PERYRRHGTH
410 420 430 440 450
SVKITGWGEE TLPDGRTLKY WTAANSWGPA WGERGHFRIV RGVNECDIES
460
FVLGVWGRVG MEDMGHH
Length:467
Mass (Da):52,387
Last modified:March 1, 2001 - v1
Checksum:iE9D72220E3E7B7D5
GO
Isoform 2 (identifier: Q9GZM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     135-194: CDQEPCLVDP...SSVMNMHEIY → MVLGSSTQVK...EADRATFILQ
     286-286: G → GYAATGDVGREEGKELRGHGLGHDALSLSAFAPSCCLCR
     365-381: ALMEVHEDFFLYKGGIY → GKPPYPAPWFQKLVPA
     382-467: Missing.

Show »
Length:284
Mass (Da):30,845
Checksum:iE389D4425C84FB08
GO
Isoform 3 (identifier: Q9GZM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-156: Missing.

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):48,807
Checksum:iE66031AF51808DCD
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6SDV2F6SDV2_HUMAN
Tubulointerstitial nephritis antige...
TINAGL1 hCG_41620
362Annotation score:

Sequence cautioni

The sequence AAH09048 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55403 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti333N → Y in AAL55753 (PubMed:15498874).Curated1
Sequence conflicti377K → E in BAB55403 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05151469A → S. Corresponds to variant dbSNP:rs17497479Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0130941 – 134Missing in isoform 2. 2 PublicationsAdd BLAST134
Alternative sequenceiVSP_043712126 – 156Missing in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_013095135 – 194CDQEP…MHEIY → MVLGSSTQVKIGGSWNPAAA GGLKIKLQKALDLVALQCQW APEGQARAEQEADRATFILQ in isoform 2. 2 PublicationsAdd BLAST60
Alternative sequenceiVSP_013096286G → GYAATGDVGREEGKELRGHG LGHDALSLSAFAPSCCLCR in isoform 2. 2 Publications1
Alternative sequenceiVSP_013097365 – 381ALMEV…KGGIY → GKPPYPAPWFQKLVPA in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_013098382 – 467Missing in isoform 2. 2 PublicationsAdd BLAST86

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155
, AF236151, AF236152, AF236153, AF236154 Genomic DNA Translation: AAG40154.1
AF236150 mRNA Translation: AAG38876.1
AF205436 mRNA Translation: AAG33699.1
AB050716 mRNA Translation: BAB18636.1
AB050719 Genomic DNA Translation: BAB18727.1
AK074124 mRNA Translation: BAB84950.1
AY358421 mRNA Translation: AAQ88787.1
AF289569 mRNA Translation: AAL55753.1
AK027839 mRNA Translation: BAB55403.1 Different initiation.
AK292770 mRNA Translation: BAF85459.1
AK298382 mRNA Translation: BAG60618.1
AK075398 mRNA Translation: BAC11596.1
AC114488 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07604.1
CH471059 Genomic DNA Translation: EAX07605.1
CH471059 Genomic DNA Translation: EAX07606.1
BC009048 mRNA Translation: AAH09048.1 Different initiation.
BC064633 mRNA Translation: AAH64633.1
CCDSiCCDS343.1 [Q9GZM7-1]
CCDS55586.1 [Q9GZM7-3]
RefSeqiNP_001191343.1, NM_001204414.1 [Q9GZM7-3]
NP_001191344.1, NM_001204415.1
NP_071447.1, NM_022164.2 [Q9GZM7-1]
UniGeneiHs.199368

Genome annotation databases

EnsembliENST00000271064; ENSP00000271064; ENSG00000142910 [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910 [Q9GZM7-3]
GeneIDi64129
KEGGihsa:64129
UCSCiuc001bta.4 human [Q9GZM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF236155
, AF236151, AF236152, AF236153, AF236154 Genomic DNA Translation: AAG40154.1
AF236150 mRNA Translation: AAG38876.1
AF205436 mRNA Translation: AAG33699.1
AB050716 mRNA Translation: BAB18636.1
AB050719 Genomic DNA Translation: BAB18727.1
AK074124 mRNA Translation: BAB84950.1
AY358421 mRNA Translation: AAQ88787.1
AF289569 mRNA Translation: AAL55753.1
AK027839 mRNA Translation: BAB55403.1 Different initiation.
AK292770 mRNA Translation: BAF85459.1
AK298382 mRNA Translation: BAG60618.1
AK075398 mRNA Translation: BAC11596.1
AC114488 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07604.1
CH471059 Genomic DNA Translation: EAX07605.1
CH471059 Genomic DNA Translation: EAX07606.1
BC009048 mRNA Translation: AAH09048.1 Different initiation.
BC064633 mRNA Translation: AAH64633.1
CCDSiCCDS343.1 [Q9GZM7-1]
CCDS55586.1 [Q9GZM7-3]
RefSeqiNP_001191343.1, NM_001204414.1 [Q9GZM7-3]
NP_001191344.1, NM_001204415.1
NP_071447.1, NM_022164.2 [Q9GZM7-1]
UniGeneiHs.199368

3D structure databases

ProteinModelPortaliQ9GZM7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122078, 21 interactors
IntActiQ9GZM7, 60 interactors
MINTiQ9GZM7
STRINGi9606.ENSP00000271064

Protein family/group databases

MEROPSiC01.975

PTM databases

GlyConnecti1864
iPTMnetiQ9GZM7
PhosphoSitePlusiQ9GZM7

Polymorphism and mutation databases

BioMutaiTINAGL1
DMDMi61213628

Proteomic databases

MaxQBiQ9GZM7
PaxDbiQ9GZM7
PeptideAtlasiQ9GZM7
PRIDEiQ9GZM7
ProteomicsDBi80089
80090 [Q9GZM7-2]
80091 [Q9GZM7-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000271064; ENSP00000271064; ENSG00000142910 [Q9GZM7-1]
ENST00000457433; ENSP00000395137; ENSG00000142910 [Q9GZM7-3]
GeneIDi64129
KEGGihsa:64129
UCSCiuc001bta.4 human [Q9GZM7-1]

Organism-specific databases

CTDi64129
DisGeNETi64129
EuPathDBiHostDB:ENSG00000142910.15
GeneCardsiTINAGL1
HGNCiHGNC:19168 TINAGL1
HPAiHPA048695
MIMi616064 gene
neXtProtiNX_Q9GZM7
OpenTargetsiENSG00000142910
PharmGKBiPA38810
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1544 Eukaryota
ENOG410YN9K LUCA
GeneTreeiENSGT00900000140859
HOGENOMiHOG000241342
HOVERGENiHBG053961
InParanoidiQ9GZM7
OMAiKYWIAAN
OrthoDBiEOG091G0A2N
PhylomeDBiQ9GZM7
TreeFamiTF313765

Miscellaneous databases

ChiTaRSiTINAGL1 human
GeneWikiiTINAGL1
GenomeRNAii64129
PROiPR:Q9GZM7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142910 Expressed in 171 organ(s), highest expression level in adult mammalian kidney
CleanExiHS_TINAGL1
ExpressionAtlasiQ9GZM7 baseline and differential
GenevisibleiQ9GZM7 HS

Family and domain databases

InterProiView protein in InterPro
IPR038765 Papain_like_cys_pep_sf
IPR025660 Pept_his_AS
IPR013128 Peptidase_C1A
IPR000668 Peptidase_C1A_C
IPR001212 Somatomedin_B_dom
PANTHERiPTHR12411 PTHR12411, 1 hit
PfamiView protein in Pfam
PF00112 Peptidase_C1, 1 hit
SMARTiView protein in SMART
SM00645 Pept_C1, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS00524 SMB_1, 1 hit
PS50958 SMB_2, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTINAL_HUMAN
AccessioniPrimary (citable) accession number: Q9GZM7
Secondary accession number(s): A8K9Q5
, B4DPK6, D3DPN8, Q8TEJ9, Q8WZ23, Q96GZ4, Q96JW3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again