Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (10 Feb 2021)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Probable LRR receptor-like serine/threonine-protein kinase RFK1

Gene

RKF1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei709ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei807Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi687 – 695ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • protein autophosphorylation Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Receptor, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable LRR receptor-like serine/threonine-protein kinase RFK1 (EC:2.7.11.1)
Alternative name(s):
Receptor-like kinase in flowers 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RKF1
Ordered Locus Names:At1g29750
ORF Names:F1N18.19, T3M22.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G29750

The Arabidopsis Information Resource

More...
TAIRi
locus:2203847, AT1G29750

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini41 – 625ExtracellularSequence analysisAdd BLAST585
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei626 – 646HelicalSequence analysisAdd BLAST21
Topological domaini647 – 1021CytoplasmicSequence analysisAdd BLAST375

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 39Sequence analysisAdd BLAST39
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000038751940 – 1021Probable LRR receptor-like serine/threonine-protein kinase RFK1Add BLAST982

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi136N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi147N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi168N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi218N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi287N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi300N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi486N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi512N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei670PhosphothreonineBy similarity1
Modified residuei754PhosphotyrosineBy similarity1
Modified residuei840PhosphoserineBy similarity1
Modified residuei841PhosphothreonineBy similarity1
Modified residuei846PhosphothreonineBy similarity1
Modified residuei854PhosphotyrosineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9FXF2

PRoteomics IDEntifications database

More...
PRIDEi
Q9FXF2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
234813 [Q9FXF2-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mostly expressed in flower buds, especially in stamens.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

First detected in early flower primordia and during stamen development. Later expressed in anthers and in pollen.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9FXF2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9FXF2, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
25088, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q9FXF2, 7 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT1G29750.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9FXF2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati99 – 122LRR 1Add BLAST24
Repeati123 – 146LRR 2Add BLAST24
Repeati148 – 168LRR 3Add BLAST21
Repeati169 – 192LRR 4Add BLAST24
Repeati193 – 216LRR 5Add BLAST24
Repeati218 – 240LRR 6Add BLAST23
Repeati241 – 266LRR 7Add BLAST26
Repeati288 – 312LRR 8Add BLAST25
Repeati313 – 336LRR 9Add BLAST24
Repeati338 – 359LRR 10Add BLAST22
Repeati361 – 381LRR 11Add BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini681 – 956Protein kinasePROSITE-ProRule annotationAdd BLAST276

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QW9B, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9FXF2

Identification of Orthologs from Complete Genome Data

More...
OMAi
WAMECED

Database of Orthologous Groups

More...
OrthoDBi
684563at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9FXF2

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR032675, LRR_dom_sf
IPR021720, Malectin_dom
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008271, Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11721, Malectin, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9FXF2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MISLYQILAE KKKKKKNDLN IFAFSVFAII CFKFYSVNAI KLPQQEVDAL
60 70 80 90 100
QQIATTLGSK FWKFDAENCK IEMVGLTETP PPTAKQEIEC ECSPTNDTDC
110 120 130 140 150
HVVKFAFKDH NLPGTLPQIV KLPYLREIDL AYNYINGTLP REWASSNLTF
160 170 180 190 200
ISLLVNRLSG EIPKEFGNSS LTYLDLESNA FSGTIPQELG NLVHLKKLLL
210 220 230 240 250
SSNKLTGTLP ASLARLQNMT DFRINDLQLS GTIPSYIQNW KQLERLEMIA
260 270 280 290 300
SGLTGPIPSV ISVLSNLVNL RISDIRGPVQ PFPSLKNVTG LTKIILKNCN
310 320 330 340 350
ISGQIPTYLS HLKELETLDL SFNKLVGGIP SFAQAENLRF IILAGNMLEG
360 370 380 390 400
DAPDELLRDG ITVDLSYNNL KWQSPESRAC RPNMNLNLNL FQSTSTKKSS
410 420 430 440 450
KFLPCIKDFK CPRYSSCLHV NCGGSDMYVK EKKTKELYEG DGNVEGGAAK
460 470 480 490 500
YFLKPDANWG FSSTGDFMDD NNFQNTRFTM FVPASNQSDL YKSARIAPVS
510 520 530 540 550
LTYFHACLEN GNYTINLDFA EIRFTNDENY NRLGRRLFDI YIQEKLVAKD
560 570 580 590 600
FNIMDEAKGA QTPIIKPLTA YVTNHFLTIR LSWAGKGTTR IPTRGVYGPI
610 620 630 640 650
ISAISIVSDS KPCERPKTGM SPGAYIAIGI GAPCLIIFIL GFLWICGCLP
660 670 680 690 700
RCGRQRKDPY EEELPSGTFT LRQIKFATDD FNPTNKIGEG GFGAVFKGVL
710 720 730 740 750
ADGRVVAVKQ LSSKSRQGNR EFLNEIGAIS CLQHPNLVKL HGFCVERAQL
760 770 780 790 800
LLAYEYMENN SLSSALFSPK HKQIPMDWPT RFKICCGIAK GLAFLHEESP
810 820 830 840 850
LKFVHRDIKA TNILLDKDLT PKISDFGLAR LDEEEKTHIS TKVAGTIGYM
860 870 880 890 900
APEYALWGYL TFKADVYSFG VLVLEIVAGI TNSNFMGAGD SVCLLEFANE
910 920 930 940 950
CVESGHLMQV VDERLRPEVD RKEAEAVIKV ALVCSSASPT DRPLMSEVVA
960 970 980 990 1000
MLEGLYPVPE STPGVSRNAG DIRFKAFKDL RRGMENNSKT QCSVKSYPSS
1010 1020
SSTSSGAGQA VQERKKEESR P
Length:1,021
Mass (Da):113,463
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9F35CBFEA5A1CC1A
GO
Isoform 2 (identifier: Q9FXF2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3-46: SLYQILAEKKKKKKNDLNIFAFSVFAIICFKFYSVNAIKLPQQE → VKAKKSVILVVAQVIELIFYDVCFCVCSL

Show »
Length:1,006
Mass (Da):111,526
Checksum:i7A66A6E688A04974
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8ATN8A0A1P8ATN8_ARATH
Non-specific serine/threonine prote...
RKF1 RECEPTOR-LIKE SERINE, THREONINE KINASE, At1g29750, F1N18.19, F1N18_19
849Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25S → P in AAC50043 (PubMed:9687063).Curated1
Sequence conflicti398 – 408KSSKFLPCIKD → NRANFCRVSR in AAC50043 (PubMed:9687063).CuratedAdd BLAST11
Sequence conflicti434T → P in AAC50043 (PubMed:9687063).Curated1
Sequence conflicti927V → G in AAC50043 (PubMed:9687063).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0382773 – 46SLYQI…LPQQE → VKAKKSVILVVAQVIELIFY DVCFCVCSL in isoform 2. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF024648 mRNA Translation: AAC50043.1
AC008030 Genomic DNA Translation: AAG10619.1
AC079288 Genomic DNA Translation: AAG50773.1
CP002684 Genomic DNA Translation: AEE31124.1
CP002684 Genomic DNA Translation: AEE31125.1
AY091006 mRNA Translation: AAM14028.1
AY142598 mRNA Translation: AAN13167.1
FJ708642 mRNA Translation: ACN59238.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A86421

NCBI Reference Sequences

More...
RefSeqi
NP_174268.7, NM_102715.8 [Q9FXF2-1]
NP_850955.5, NM_180624.6 [Q9FXF2-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G29750.1; AT1G29750.1; AT1G29750 [Q9FXF2-2]
AT1G29750.2; AT1G29750.2; AT1G29750 [Q9FXF2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
839853

Gramene; a comparative resource for plants

More...
Gramenei
AT1G29750.1; AT1G29750.1; AT1G29750 [Q9FXF2-2]
AT1G29750.2; AT1G29750.2; AT1G29750 [Q9FXF2-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G29750

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF024648 mRNA Translation: AAC50043.1
AC008030 Genomic DNA Translation: AAG10619.1
AC079288 Genomic DNA Translation: AAG50773.1
CP002684 Genomic DNA Translation: AEE31124.1
CP002684 Genomic DNA Translation: AEE31125.1
AY091006 mRNA Translation: AAM14028.1
AY142598 mRNA Translation: AAN13167.1
FJ708642 mRNA Translation: ACN59238.1
PIRiA86421
RefSeqiNP_174268.7, NM_102715.8 [Q9FXF2-1]
NP_850955.5, NM_180624.6 [Q9FXF2-2]

3D structure databases

SMRiQ9FXF2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi25088, 6 interactors
IntActiQ9FXF2, 7 interactors
STRINGi3702.AT1G29750.2

Proteomic databases

PaxDbiQ9FXF2
PRIDEiQ9FXF2
ProteomicsDBi234813 [Q9FXF2-1]

Genome annotation databases

EnsemblPlantsiAT1G29750.1; AT1G29750.1; AT1G29750 [Q9FXF2-2]
AT1G29750.2; AT1G29750.2; AT1G29750 [Q9FXF2-1]
GeneIDi839853
GrameneiAT1G29750.1; AT1G29750.1; AT1G29750 [Q9FXF2-2]
AT1G29750.2; AT1G29750.2; AT1G29750 [Q9FXF2-1]
KEGGiath:AT1G29750

Organism-specific databases

AraportiAT1G29750
TAIRilocus:2203847, AT1G29750

Phylogenomic databases

eggNOGiENOG502QW9B, Eukaryota
InParanoidiQ9FXF2
OMAiWAMECED
OrthoDBi684563at2759
PhylomeDBiQ9FXF2

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9FXF2

Gene expression databases

ExpressionAtlasiQ9FXF2, baseline and differential
GenevisibleiQ9FXF2, AT

Family and domain databases

Gene3Di3.80.10.10, 3 hits
InterProiView protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR032675, LRR_dom_sf
IPR021720, Malectin_dom
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR008271, Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF11721, Malectin, 1 hit
PF07714, PK_Tyr_Ser-Thr, 1 hit
SMARTiView protein in SMART
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRKF1_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FXF2
Secondary accession number(s): O22579, Q8RWZ9, Q9C6G6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 3, 2009
Last sequence update: March 1, 2001
Last modified: February 10, 2021
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again