Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor E2FA

Gene

E2FA

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The binding of retinoblastoma-related proteins represses transactivation. Regulates gene expression both positively and negatively. Activates the expression of E2FB. Involved in the control of cell-cycle progression from G1 to S phase. Stimulates cell proliferation and delays differentiation.9 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi167 – 232Add BLAST66

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-ATH-1538133 G0 and Early G1
R-ATH-68689 CDC6 association with the ORC:origin complex
R-ATH-68911 G2 Phase
R-ATH-69231 Cyclin D associated events in G1
R-ATH-8953750 Transcriptional Regulation by E2F6

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor E2FA
Alternative name(s):
E2F transcription factor-3
Short name:
AtE2F3
Gene namesi
Name:E2FA
Synonyms:E2F3, E2F4
Ordered Locus Names:At2g36010
ORF Names:F11F19.8
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 2

Organism-specific databases

AraportiAT2G36010

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004062891 – 485Transcription factor E2FAAdd BLAST485

Expressioni

Tissue specificityi

Highly expressed in the shoot apical meristem, emerging leaf primordia, and vascular tissues of young leaf primordia. Expressed in flowers, in epidermis and cortex of hypocotyls, and at lower levels in leaves.2 Publications

Developmental stagei

Expressed in a cell cycle-dependent manner. Most abundant in early S phase. Decreased expression during the passage into G2.3 Publications

Gene expression databases

ExpressionAtlasiQ9FNY0 baseline and differential
GenevisibleiQ9FNY0 AT

Interactioni

Subunit structurei

Heterodimer with DP proteins. Interacts (via dimerization domain) preferentially with DPA, but also with DPB. Interacts with maize retinoblastoma-related protein RBR1. No interaction with E2FD.5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi3518, 17 interactors
DIPiDIP-40175N
IntActiQ9FNY0, 11 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9FNY0
SMRiQ9FNY0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni249 – 277Leucine-zipperAdd BLAST29
Regioni435 – 450Retinoblastoma protein bindingSequence analysisAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili245 – 286Sequence analysisAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 53Pro-richAdd BLAST45

Domaini

The C-terminal region (366-485) is required for transactivational activity. The N-terminal region (92-128) is important for nuclear localization.

Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

HOGENOMiHOG000232044
InParanoidiQ9FNY0
KOiK06620
PhylomeDBiQ9FNY0

Family and domain databases

CDDicd14660 E2F_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR015633 E2F
IPR037241 E2F-DP_heterodim
IPR032198 E2F_CC-MB
IPR003316 E2F_WHTH_DNA-bd_dom
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12081 PTHR12081, 1 hit
PfamiView protein in Pfam
PF16421 E2F_CC-MB, 1 hit
PF02319 E2F_TDP, 1 hit
SMARTiView protein in SMART
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9FNY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGVVRSSPG SSQPPPPPPH HPPSSPVPVT STPVIPPIRR HLAFASTKPP
60 70 80 90 100
FHPSDDYHRF NPSSLSNNND RSFVHGCGVV DREEDAVVVR SPSRKRKATM
110 120 130 140 150
DMVVAPSNNG FTSSGFTNIP SSPCQTPRKG GRVNIKSKAK GNKSTPQTPI
160 170 180 190 200
STNAGSPITL TPSGSCRYDS SLGLLTKKFV NLIKQAKDGM LDLNKAAETL
210 220 230 240 250
EVQKRRIYDI TNVLEGIDLI EKPFKNRILW KGVDACPGDE DADVSVLQLQ
260 270 280 290 300
AEIENLALEE QALDNQIRQT EERLRDLSEN EKNQKWLFVT EEDIKSLPGF
310 320 330 340 350
QNQTLIAVKA PHGTTLEVPD PDEAADHPQR RYRIILRSTM GPIDVYLVSE
360 370 380 390 400
FEGKFEDTNG SGAAPPACLP IASSSGSTGH HDIEALTVDN PETAIVSHDH
410 420 430 440 450
PHPQPGDTSD LNYLQEQVGG MLKITPSDVE NDESDYWLLS NAEISMTDIW
460 470 480
KTDSGIDWDY GIADVSTPPP GMGEIAPTAV DSTPR
Length:485
Mass (Da):52,839
Last modified:March 1, 2001 - v1
Checksum:i838A5AD7A31B035C
GO
Isoform 2 (identifier: Q9FNY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-248: Missing.

Show »
Length:483
Mass (Da):52,598
Checksum:i63B41EDCD742A4CB
GO
Isoform 3 (identifier: Q9FNY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-92: P → PIFPSEIGLEIRGCFGDFDCYLLLLSLIQKLRSVRLSSIRVNFCRLFSFAM
     155-173: GSPITLTPSGSCRYDSSLG → VRSFYEISFMSRVTS

Show »
Length:531
Mass (Da):58,521
Checksum:i34AE922E7B40BE69
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F4ILT1F4ILT1_ARATH
E2F transcription factor 3
E2F3 ATE2FA, E2F transcription factor 3, At2g36010, F11F19.8, F11F19_8
514Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti264D → G in CAC15486 (PubMed:11108847).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04080192P → PIFPSEIGLEIRGCFGDFDC YLLLLSLIQKLRSVRLSSIR VNFCRLFSFAM in isoform 3. 1 Publication1
Alternative sequenceiVSP_040802155 – 173GSPIT…DSSLG → VRSFYEISFMSRVTS in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_040803247 – 248Missing in isoform 2. Curated2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ294534 mRNA Translation: CAC15486.1
AF242582 mRNA Translation: AAG17610.1
AJ276619 mRNA Translation: CAC34724.1
AJ271597 mRNA Translation: CAB70599.1
AC007017 Genomic DNA Translation: AAD21456.2
CP002685 Genomic DNA Translation: AEC09191.1
CP002685 Genomic DNA Translation: AEC09192.1
BT026376 mRNA Translation: ABH04483.1
PIRiG84775
RefSeqiNP_565831.3, NM_129160.4 [Q9FNY0-2]
NP_973610.1, NM_201881.2
NP_973611.1, NM_201882.3 [Q9FNY0-1]
UniGeneiAt.10190
At.64435

Genome annotation databases

EnsemblPlantsiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
GeneIDi818174
GrameneiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
KEGGiath:AT2G36010

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ294534 mRNA Translation: CAC15486.1
AF242582 mRNA Translation: AAG17610.1
AJ276619 mRNA Translation: CAC34724.1
AJ271597 mRNA Translation: CAB70599.1
AC007017 Genomic DNA Translation: AAD21456.2
CP002685 Genomic DNA Translation: AEC09191.1
CP002685 Genomic DNA Translation: AEC09192.1
BT026376 mRNA Translation: ABH04483.1
PIRiG84775
RefSeqiNP_565831.3, NM_129160.4 [Q9FNY0-2]
NP_973610.1, NM_201881.2
NP_973611.1, NM_201882.3 [Q9FNY0-1]
UniGeneiAt.10190
At.64435

3D structure databases

ProteinModelPortaliQ9FNY0
SMRiQ9FNY0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi3518, 17 interactors
DIPiDIP-40175N
IntActiQ9FNY0, 11 interactors

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
GeneIDi818174
GrameneiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
KEGGiath:AT2G36010

Organism-specific databases

AraportiAT2G36010

Phylogenomic databases

HOGENOMiHOG000232044
InParanoidiQ9FNY0
KOiK06620
PhylomeDBiQ9FNY0

Enzyme and pathway databases

ReactomeiR-ATH-1538133 G0 and Early G1
R-ATH-68689 CDC6 association with the ORC:origin complex
R-ATH-68911 G2 Phase
R-ATH-69231 Cyclin D associated events in G1
R-ATH-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

PROiPR:Q9FNY0

Gene expression databases

ExpressionAtlasiQ9FNY0 baseline and differential
GenevisibleiQ9FNY0 AT

Family and domain databases

CDDicd14660 E2F_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR015633 E2F
IPR037241 E2F-DP_heterodim
IPR032198 E2F_CC-MB
IPR003316 E2F_WHTH_DNA-bd_dom
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12081 PTHR12081, 1 hit
PfamiView protein in Pfam
PF16421 E2F_CC-MB, 1 hit
PF02319 E2F_TDP, 1 hit
SMARTiView protein in SMART
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiE2FA_ARATH
AccessioniPrimary (citable) accession number: Q9FNY0
Secondary accession number(s): Q9C5B5
, Q9FV69, Q9M454, Q9SJ49
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 5, 2011
Last sequence update: March 1, 2001
Last modified: September 12, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again