Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (31 Jul 2019)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transcription factor E2FA

Gene

E2FA

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The binding of retinoblastoma-related proteins represses transactivation. Regulates gene expression both positively and negatively. Activates the expression of E2FB. Involved in the control of cell-cycle progression from G1 to S phase. Stimulates cell proliferation and delays differentiation.9 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi167 – 232Add BLAST66

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processCell cycle, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor E2FA
Alternative name(s):
E2F transcription factor-3
Short name:
AtE2F3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:E2FA
Synonyms:E2F3, E2F4
Ordered Locus Names:At2g36010
ORF Names:F11F19.8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G36010

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004062891 – 485Transcription factor E2FAAdd BLAST485

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the shoot apical meristem, emerging leaf primordia, and vascular tissues of young leaf primordia. Expressed in flowers, in epidermis and cortex of hypocotyls, and at lower levels in leaves.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in a cell cycle-dependent manner. Most abundant in early S phase. Decreased expression during the passage into G2.3 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9FNY0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9FNY0 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with DP proteins.

Interacts (via dimerization domain) preferentially with DPA, but also with DPB.

Interacts with maize retinoblastoma-related protein RBR1. No interaction with E2FD.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
3518, 17 interactors

Database of interacting proteins

More...
DIPi
DIP-40175N

Protein interaction database and analysis system

More...
IntActi
Q9FNY0, 11 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9FNY0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni249 – 277Leucine-zipperAdd BLAST29
Regioni435 – 450Retinoblastoma protein bindingSequence analysisAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili245 – 286Sequence analysisAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi9 – 53Pro-richAdd BLAST45

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal region (366-485) is required for transactivational activity. The N-terminal region (92-128) is important for nuclear localization.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the E2F/DP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232044

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9FNY0

KEGG Orthology (KO)

More...
KOi
K06620

Identification of Orthologs from Complete Genome Data

More...
OMAi
QTHQICS

Database of Orthologous Groups

More...
OrthoDBi
1087250at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9FNY0

Family and domain databases

Conserved Domains Database

More...
CDDi
cd14660 E2F_DD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015633 E2F
IPR037241 E2F-DP_heterodim
IPR032198 E2F_CC-MB
IPR003316 E2F_WHTH_DNA-bd_dom
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12081 PTHR12081, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16421 E2F_CC-MB, 1 hit
PF02319 E2F_TDP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01372 E2F_TDP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9FNY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGVVRSSPG SSQPPPPPPH HPPSSPVPVT STPVIPPIRR HLAFASTKPP
60 70 80 90 100
FHPSDDYHRF NPSSLSNNND RSFVHGCGVV DREEDAVVVR SPSRKRKATM
110 120 130 140 150
DMVVAPSNNG FTSSGFTNIP SSPCQTPRKG GRVNIKSKAK GNKSTPQTPI
160 170 180 190 200
STNAGSPITL TPSGSCRYDS SLGLLTKKFV NLIKQAKDGM LDLNKAAETL
210 220 230 240 250
EVQKRRIYDI TNVLEGIDLI EKPFKNRILW KGVDACPGDE DADVSVLQLQ
260 270 280 290 300
AEIENLALEE QALDNQIRQT EERLRDLSEN EKNQKWLFVT EEDIKSLPGF
310 320 330 340 350
QNQTLIAVKA PHGTTLEVPD PDEAADHPQR RYRIILRSTM GPIDVYLVSE
360 370 380 390 400
FEGKFEDTNG SGAAPPACLP IASSSGSTGH HDIEALTVDN PETAIVSHDH
410 420 430 440 450
PHPQPGDTSD LNYLQEQVGG MLKITPSDVE NDESDYWLLS NAEISMTDIW
460 470 480
KTDSGIDWDY GIADVSTPPP GMGEIAPTAV DSTPR
Length:485
Mass (Da):52,839
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i838A5AD7A31B035C
GO
Isoform 2 (identifier: Q9FNY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-248: Missing.

Show »
Length:483
Mass (Da):52,598
Checksum:i63B41EDCD742A4CB
GO
Isoform 3 (identifier: Q9FNY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-92: P → PIFPSEIGLEIRGCFGDFDCYLLLLSLIQKLRSVRLSSIRVNFCRLFSFAM
     155-173: GSPITLTPSGSCRYDSSLG → VRSFYEISFMSRVTS

Show »
Length:531
Mass (Da):58,521
Checksum:i34AE922E7B40BE69
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F4ILT1F4ILT1_ARATH
E2F transcription factor 3
E2F3 ATE2FA, E2F transcription factor 3, At2g36010, F11F19.8, F11F19_8
514Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti264D → G in CAC15486 (PubMed:11108847).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04080192P → PIFPSEIGLEIRGCFGDFDC YLLLLSLIQKLRSVRLSSIR VNFCRLFSFAM in isoform 3. 1 Publication1
Alternative sequenceiVSP_040802155 – 173GSPIT…DSSLG → VRSFYEISFMSRVTS in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_040803247 – 248Missing in isoform 2. Curated2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ294534 mRNA Translation: CAC15486.1
AF242582 mRNA Translation: AAG17610.1
AJ276619 mRNA Translation: CAC34724.1
AJ271597 mRNA Translation: CAB70599.1
AC007017 Genomic DNA Translation: AAD21456.2
CP002685 Genomic DNA Translation: AEC09191.1
CP002685 Genomic DNA Translation: AEC09192.1
BT026376 mRNA Translation: ABH04483.1

Protein sequence database of the Protein Information Resource

More...
PIRi
G84775

NCBI Reference Sequences

More...
RefSeqi
NP_565831.3, NM_129160.4 [Q9FNY0-2]
NP_973610.1, NM_201881.2
NP_973611.1, NM_201882.3 [Q9FNY0-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
818174

Gramene; a comparative resource for plants

More...
Gramenei
AT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G36010

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ294534 mRNA Translation: CAC15486.1
AF242582 mRNA Translation: AAG17610.1
AJ276619 mRNA Translation: CAC34724.1
AJ271597 mRNA Translation: CAB70599.1
AC007017 Genomic DNA Translation: AAD21456.2
CP002685 Genomic DNA Translation: AEC09191.1
CP002685 Genomic DNA Translation: AEC09192.1
BT026376 mRNA Translation: ABH04483.1
PIRiG84775
RefSeqiNP_565831.3, NM_129160.4 [Q9FNY0-2]
NP_973610.1, NM_201881.2
NP_973611.1, NM_201882.3 [Q9FNY0-1]

3D structure databases

SMRiQ9FNY0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi3518, 17 interactors
DIPiDIP-40175N
IntActiQ9FNY0, 11 interactors

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
GeneIDi818174
GrameneiAT2G36010.1; AT2G36010.1; AT2G36010 [Q9FNY0-2]
AT2G36010.3; AT2G36010.3; AT2G36010 [Q9FNY0-1]
KEGGiath:AT2G36010

Organism-specific databases

AraportiAT2G36010

Phylogenomic databases

HOGENOMiHOG000232044
InParanoidiQ9FNY0
KOiK06620
OMAiQTHQICS
OrthoDBi1087250at2759
PhylomeDBiQ9FNY0

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9FNY0

Gene expression databases

ExpressionAtlasiQ9FNY0 baseline and differential
GenevisibleiQ9FNY0 AT

Family and domain databases

CDDicd14660 E2F_DD, 1 hit
Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR015633 E2F
IPR037241 E2F-DP_heterodim
IPR032198 E2F_CC-MB
IPR003316 E2F_WHTH_DNA-bd_dom
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR12081 PTHR12081, 1 hit
PfamiView protein in Pfam
PF16421 E2F_CC-MB, 1 hit
PF02319 E2F_TDP, 1 hit
SMARTiView protein in SMART
SM01372 E2F_TDP, 1 hit
SUPFAMiSSF144074 SSF144074, 1 hit
SSF46785 SSF46785, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiE2FA_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FNY0
Secondary accession number(s): Q9C5B5
, Q9FV69, Q9M454, Q9SJ49
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 5, 2011
Last sequence update: March 1, 2001
Last modified: July 31, 2019
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again