Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (29 Sep 2021)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Fumarate hydratase 2

Gene

FUM2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytosolic fumarate hydratase that catalyzes the reversible stereospecific interconversion of fumarate to L-malate (PubMed:29688630).

Catalyzes the dehydration of L-malate to fumarate in the cytosol: required for the massive fumarate accumulation during the day in plants grown under high nitrogen (PubMed:20202172).

Also required for acclimation of photosynthesis to cold: acts by mediating accumulation of fumarate at low temperature, leading to reduce accumulation of phosphorylated sugars (PubMed:27440755).

3 Publications

Miscellaneous

There are 2 substrate-binding sites: the catalytic A site, and the non-catalytic B site that may play a role in the transfer of substrate or product between the active site and the solvent. Alternatively, the B site may bind allosteric effectors.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Fumarate hydratase activity (fumarate to L-malate) is strongly inhibited by phosphoenolpyruvate, citrate, oxaloacetate, ATP and ADP (PubMed:29688630). Malate dehydratase activity (malate to fumarate) is activated by oxaloacetate, Asn and Gln (PubMed:29688630). Malate dehydratase activity (malate to fumarate) is inhibited by citrate, succinate, ADP and ATP (PubMed:29688630).1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat is 23.04 sec(-1) for fumarate (at pH 7.7) (PubMed:29688630). Kcat is 22.15 sec(-1) for fumarate (at pH 8.0) (PubMed:29688630). Kcat is 18.3 sec(-1) for fumarate (at pH 8.2) (PubMed:29688630). Kcat is 5.22 sec(-1) for (S)-malate (at pH 7.7) (PubMed:29688630). Kcat is 14.79 sec(-1) for (S)-malate (at pH 8.0) (PubMed:29688630). Kcat is 17.1 sec(-1) for (S)-malate (at pH 8.2) (PubMed:29688630).1 Publication
  1. KM=0.4 mM for fumarate (at pH 7.7)1 Publication
  2. KM=0.6 mM for (S)-malate (at pH 7.7)1 Publication
  3. KM=0.5 mM for fumarate (at pH 8.0)1 Publication
  4. KM=1.7 mM for (S)-malate (at pH 8.0)1 Publication
  5. KM=0.5 mM for fumarate (at pH 8.2)1 Publication
  6. KM=1.9 mM for (S)-malate (at pH 8.2)1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei222SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei223Proton donor/acceptorBy similarity1
Active sitei353By similarity1
Binding sitei354SubstrateBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei366Important for catalytic activityBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
ARA:AT5G50950-MONOMER
MetaCyc:AT5G50950-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
4.2.1.2, 399

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fumarate hydratase 21 Publication (EC:4.2.1.21 Publication)
Short name:
AtFUM21 Publication
Short name:
Fumarase 21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FUM21 Publication
Ordered Locus Names:At5g50950
ORF Names:K3K7.11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G50950

The Arabidopsis Information Resource

More...
TAIRi
locus:2157413, AT5G50950

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Decreased fumarate levels, while malate levels increase (PubMed:20202172). Leaves display lower levels of many amino acids during the day, but higher levels at night, consistent with a link between fumarate and amino acid metabolism (PubMed:20202172). Plants are unable to acclimate photosynthesis in response to cold (PubMed:27440755).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000103301 – 499Fumarate hydratase 2Add BLAST499

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9FI53

PRoteomics IDEntifications database

More...
PRIDEi
Q9FI53

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
228890 [Q9FI53-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9FI53, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9FI53, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
20414, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9FI53, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT5G50950.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9FI53

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni19 – 51DisorderedSequence analysisAdd BLAST33
Regioni134 – 136Substrate bindingBy similarity3
Regioni164 – 167Substrate binding (B site)By similarity4
Regioni174 – 176Substrate bindingBy similarity3
Regioni359 – 361Substrate bindingBy similarity3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi19 – 40Basic and acidic residuesSequence analysisAdd BLAST22

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1317, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9FI53

Identification of Orthologs from Complete Genome Data

More...
OMAi
SAPNFFE

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9FI53

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01362, Fumarase_classII, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.275.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00743, FumaraseC, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005677, Fum_hydII
IPR024083, Fumarase/histidase_N
IPR018951, Fumarase_C_C
IPR020557, Fumarate_lyase_CS
IPR000362, Fumarate_lyase_fam
IPR022761, Fumarate_lyase_N
IPR008948, L-Aspartase-like

The PANTHER Classification System

More...
PANTHERi
PTHR11444, PTHR11444, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10415, FumaraseC_C, 1 hit
PF00206, Lyase_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00149, FUMRATELYASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48557, SSF48557, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00979, fumC_II, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00163, FUMARATE_LYASES, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9FI53-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALTMQFEG EKKNVSEVAD VTLKQEDEQQ ERRSYSTPFR EERDTFGPIQ
60 70 80 90 100
VPSDKLWGAQ TQRSLQNFEI GGDRERMPEP IVRAFGVLKK CAAKVNMEYG
110 120 130 140 150
LDPMIGEAIM EAAQEVAEGK LNDHFPLVVW QTGSGTQSNM NANEVIANRA
160 170 180 190 200
AEILGHKRGE KIVHPNDHVN RSQSSNDTFP TVMHIAAATE ITSRLIPSLK
210 220 230 240 250
NLHSSLESKS FEFKDIVKIG RTHTQDATPL TLGQEFGGYA TQVEYGLNRV
260 270 280 290 300
ACTLPRIYQL AQGGTAVGTG LNTKKGFDVK IAAAVAEETN LPFVTAENKF
310 320 330 340 350
EALAAHDACV ETSGSLNTIA TSLMKIANDI RFLGSGPRCG LGELSLPENE
360 370 380 390 400
PGSSIMPGKV NPTQCEALTM VCAQVMGNHV AVTIGGSNGH FELNVFKPVI
410 420 430 440 450
ASALLHSIRL IADASASFEK NCVRGIEANR ERISKLLHES LMLVTSLNPK
460 470 480 490
IGYDNAAAVA KRAHKEGCTL KHAAMKLGVL TSEEFDTLVV PEKMIGPSD
Length:499
Mass (Da):54,084
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA84422EB032FCB4E
GO
Isoform 2 (identifier: Q9FI53-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     472-499: HAAMKLGVLTSEEFDTLVVPEKMIGPSD → VNNKLLTFSSLNKSEFKPIFSKRKHVHVCYNIFVVLFWI

Show »
Length:510
Mass (Da):55,766
Checksum:i4B192A14B3DD12D9
GO
Isoform 3 (identifier: Q9FI53-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     210-214: SFEFK → VTHLM
     215-499: Missing.

Show »
Length:214
Mass (Da):23,885
Checksum:iB56D413A83C88E25
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8BDR1A0A1P8BDR1_ARATH
Fumarate hydratase
FUM2 FUMARASE 2, At5g50950, K3K7.11, K3K7_11
408Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3H477B3H477_ARATH
Fumarate hydratase
FUM2 FUMARASE 2, At5g50950, K3K7.11, K3K7_11
317Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011356210 – 214SFEFK → VTHLM in isoform 3. 1 Publication5
Alternative sequenceiVSP_011357215 – 499Missing in isoform 3. 1 PublicationAdd BLAST285
Alternative sequenceiVSP_011355472 – 499HAAMK…IGPSD → VNNKLLTFSSLNKSEFKPIF SKRKHVHVCYNIFVVLFWI in isoform 2. CuratedAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB017063 Genomic DNA Translation: BAB08741.1
CP002688 Genomic DNA Translation: AED96014.1
CP002688 Genomic DNA Translation: AED96015.1
AY052197 mRNA Translation: AAK97668.1
AY072393 mRNA Translation: AAL62385.1
AY113070 mRNA Translation: AAM47378.1

NCBI Reference Sequences

More...
RefSeqi
NP_199908.1, NM_124474.4 [Q9FI53-1]
NP_851166.1, NM_180835.3 [Q9FI53-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
835168

Gramene; a comparative resource for plants

More...
Gramenei
AT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G50950

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB017063 Genomic DNA Translation: BAB08741.1
CP002688 Genomic DNA Translation: AED96014.1
CP002688 Genomic DNA Translation: AED96015.1
AY052197 mRNA Translation: AAK97668.1
AY072393 mRNA Translation: AAL62385.1
AY113070 mRNA Translation: AAM47378.1
RefSeqiNP_199908.1, NM_124474.4 [Q9FI53-1]
NP_851166.1, NM_180835.3 [Q9FI53-2]

3D structure databases

SMRiQ9FI53
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi20414, 1 interactor
IntActiQ9FI53, 1 interactor
STRINGi3702.AT5G50950.1

Proteomic databases

PaxDbiQ9FI53
PRIDEiQ9FI53
ProteomicsDBi228890 [Q9FI53-1]

Genome annotation databases

EnsemblPlantsiAT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]
GeneIDi835168
GrameneiAT5G50950.1; AT5G50950.1; AT5G50950 [Q9FI53-2]
AT5G50950.2; AT5G50950.2; AT5G50950 [Q9FI53-1]
KEGGiath:AT5G50950

Organism-specific databases

AraportiAT5G50950
TAIRilocus:2157413, AT5G50950

Phylogenomic databases

eggNOGiKOG1317, Eukaryota
InParanoidiQ9FI53
OMAiSAPNFFE
PhylomeDBiQ9FI53

Enzyme and pathway databases

BioCyciARA:AT5G50950-MONOMER
MetaCyc:AT5G50950-MONOMER
BRENDAi4.2.1.2, 399

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9FI53

Gene expression databases

ExpressionAtlasiQ9FI53, baseline and differential
GenevisibleiQ9FI53, AT

Family and domain databases

CDDicd01362, Fumarase_classII, 1 hit
Gene3Di1.10.275.10, 1 hit
HAMAPiMF_00743, FumaraseC, 1 hit
InterProiView protein in InterPro
IPR005677, Fum_hydII
IPR024083, Fumarase/histidase_N
IPR018951, Fumarase_C_C
IPR020557, Fumarate_lyase_CS
IPR000362, Fumarate_lyase_fam
IPR022761, Fumarate_lyase_N
IPR008948, L-Aspartase-like
PANTHERiPTHR11444, PTHR11444, 1 hit
PfamiView protein in Pfam
PF10415, FumaraseC_C, 1 hit
PF00206, Lyase_1, 1 hit
PRINTSiPR00149, FUMRATELYASE
SUPFAMiSSF48557, SSF48557, 1 hit
TIGRFAMsiTIGR00979, fumC_II, 1 hit
PROSITEiView protein in PROSITE
PS00163, FUMARATE_LYASES, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFUM2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FI53
Secondary accession number(s): Q8VY72
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 2003
Last sequence update: March 1, 2001
Last modified: September 29, 2021
This is version 146 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again