Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (02 Jun 2021)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Zeaxanthin epoxidase, chloroplastic

Gene

ZEP

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Zeaxanthin epoxidase that plays an important role in the xanthophyll cycle and abscisic acid (ABA) biosynthesis. Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Required for resistance to osmotic and drought stresses, ABA-dependent stomatal closure, seed development and dormancy, modulation of defense gene expression and disease resistance and non-photochemical quencing (NPQ). Through its role in ABA biosynthesis, regulates the expression of stress-responsive genes such as RD29A during osmotic stress and is required for normal plant growth during vegetative development. Is required for late skotomorphogenic growth through its role in the xanthophyll carotenoids neoxanthin, violaxanthin and antheraxanthin biosynthesis. Required for beta-aminobutyric acid (BABA)-induced priming in disease resistance, tolerance to salt and drought stresses and sterility. Participates in NPQ by regulating the level of zeaxanthin in photosynthetic energy conversion. NPQ is a process that maintains the balance between dissipation and utilization of light energy to minimize the generation of oxidizing molecules and the molecular damages they can generate.

13 Publications

Miscellaneous

Plants overexpressing ZEP show increased levels of violaxanthin and ABA and increased tolerance to salt and drought stresses.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADCurated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: abscisate biosynthesis

This protein is involved in the pathway abscisate biosynthesis, which is part of Plant hormone biosynthesis.
View all proteins of this organism that are known to be involved in the pathway abscisate biosynthesis and in Plant hormone biosynthesis.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi82 – 110FADSequence analysisAdd BLAST29
Nucleotide bindingi360 – 373FADSequence analysisAdd BLAST14

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processAbscisic acid biosynthesis, Stress response
LigandFAD, Flavoprotein

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:AT5G67030-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.14.15.21, 399

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00090

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zeaxanthin epoxidase, chloroplastic (EC:1.14.15.21)
Short name:
AtZEP
Alternative name(s):
Protein ABA DEFICIENT 1
Short name:
AtABA1
Protein IMPAIRED IN BABA-INDUCED STERILITY 3
Protein LOW EXPRESSION OF OSMOTIC STRESS-RESPONSIVE GENES 6
Protein NON-PHOTOCHEMICAL QUENCHING 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZEP
Synonyms:ABA1, IBS3, LOS6, NPQ2
Ordered Locus Names:At5g67030
ORF Names:K8A10.10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G67030

The Arabidopsis Information Resource

More...
TAIRi
locus:2158083, AT5G67030

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chloroplast, Plastid

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Increased endogenous level of zeaxanthin and reduced level of ABA. Reduced size of leaves, inflorescences and flowers, early flowering, increased number of wilted plants, premature seed germination and reduced osmotic water permeability and ability to close stomata. Reduced susceptibility to virulent isolates of P.parasitica and sensitivity to BABA-induced priming.8 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi125P → A in aba1-3; ABA-deficient phenotype. 1
Mutagenesisi160G → S in aba1-6; ABA-deficient phenotype. 1
Mutagenesisi386G → E in los6; reduces plant size, accelerates flowering and increases transpirational water loss. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 59ChloroplastSequence analysisAdd BLAST59
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041207260 – 667Zeaxanthin epoxidase, chloroplasticAdd BLAST608

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9FGC7

PRoteomics IDEntifications database

More...
PRIDEi
Q9FGC7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
242947 [Q9FGC7-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in leaves, stems and flowers, and at lower levels in roots and siliques.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By ABA and drought, salt and osmotic stresses.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9FGC7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9FGC7, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT5G67030.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9FGC7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini558 – 612FHAPROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2614, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009665_16_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9FGC7

Identification of Orthologs from Complete Genome Data

More...
OMAi
IFGGWCD

Database of Orthologous Groups

More...
OrthoDBi
521070at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9FGC7

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060, FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.50.50.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002938, FAD-bd
IPR036188, FAD/NAD-bd_sf
IPR000253, FHA_dom
IPR008984, SMAD_FHA_dom_sf
IPR017079, Zeaxanthin_epoxidase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01494, FAD_binding_3, 2 hits
PF00498, FHA, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF036989, Zeaxanthin_epoxidase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240, FHA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879, SSF49879, 1 hit
SSF51905, SSF51905, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9FGC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSTPFCYSI NPSPSKLDFT RTHVFSPVSK QFYLDLSSFS GKPGGVSGFR
60 70 80 90 100
SRRALLGVKA ATALVEKEEK REAVTEKKKK SRVLVAGGGI GGLVFALAAK
110 120 130 140 150
KKGFDVLVFE KDLSAIRGEG KYRGPIQIQS NALAALEAID IEVAEQVMEA
160 170 180 190 200
GCITGDRING LVDGISGTWY VKFDTFTPAA SRGLPVTRVI SRMTLQQILA
210 220 230 240 250
RAVGEDVIRN ESNVVDFEDS GDKVTVVLEN GQRYEGDLLV GADGIWSKVR
260 270 280 290 300
NNLFGRSEAT YSGYTCYTGI ADFIPADIES VGYRVFLGHK QYFVSSDVGG
310 320 330 340 350
GKMQWYAFHE EPAGGADAPN GMKKRLFEIF DGWCDNVLDL LHATEEEAIL
360 370 380 390 400
RRDIYDRSPG FTWGKGRVTL LGDSIHAMQP NMGQGGCMAI EDSFQLALEL
410 420 430 440 450
DEAWKQSVET TTPVDVVSSL KRYEESRRLR VAIIHAMARM AAIMASTYKA
460 470 480 490 500
YLGVGLGPLS FLTKFRVPHP GRVGGRFFVD IAMPSMLDWV LGGNSEKLQG
510 520 530 540 550
RPPSCRLTDK ADDRLREWFE DDDALERTIK GEWYLIPHGD DCCVSETLCL
560 570 580 590 600
TKDEDQPCIV GSEPDQDFPG MRIVIPSSQV SKMHARVIYK DGAFFLMDLR
610 620 630 640 650
SEHGTYVTDN EGRRYRATPN FPARFRSSDI IEFGSDKKAA FRVKVIRKTP
660
KSTRKNESNN DKLLQTA
Length:667
Mass (Da):73,842
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89A0A6E6B8A26D5D
GO
Isoform 2 (identifier: Q9FGC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-610: SKMHARVIYKDGAFFLMDLRSEHGTYVTDN → YKLYACSCDLQRRSFLLDGSSKRTRNLCDR
     611-667: Missing.

Show »
Length:610
Mass (Da):67,328
Checksum:i53A5C3BE6078F2E1
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL91193 differs from that shown. Intron retention.Curated
The sequence AAO00920 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29S → A in AAG17703 (Ref. 3) Curated1
Sequence conflicti29S → A in AAG38877 (Ref. 3) Curated1
Sequence conflicti42 – 54KPGGV…RSRRA → RSGGGLSVFRSRKT in AAG17703 (Ref. 3) CuratedAdd BLAST13
Sequence conflicti42 – 54KPGGV…RSRRA → RSGGGLSVFRSRKT in AAG38877 (Ref. 3) CuratedAdd BLAST13
Sequence conflicti76E → D in AAF82390 (Ref. 2) Curated1
Sequence conflicti76E → D in AAF82391 (Ref. 2) Curated1
Sequence conflicti77Missing in AAG17703 (Ref. 3) Curated1
Sequence conflicti77Missing in AAG38877 (Ref. 3) Curated1
Sequence conflicti116I → M in AAF82390 (Ref. 2) Curated1
Sequence conflicti116I → M in AAF82391 (Ref. 2) Curated1
Sequence conflicti180 – 182ASR → GVT in AAF82390 (Ref. 2) Curated3
Sequence conflicti180 – 182ASR → GVT in AAF82391 (Ref. 2) Curated3
Sequence conflicti194T → I in BAB11935 (PubMed:10859185).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041638581 – 610SKMHA…YVTDN → YKLYACSCDLQRRSFLLDGS SKRTRNLCDR in isoform 2. CuratedAdd BLAST30
Alternative sequenceiVSP_041639611 – 667Missing in isoform 2. CuratedAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB030296 mRNA Translation: BAB11935.1
AF134577 Genomic DNA Translation: AAF82390.1
AF134578 mRNA Translation: AAF82391.1
AF281655 mRNA Translation: AAG17703.1
AF283761 Genomic DNA Translation: AAG38877.1
AB026640 Genomic DNA Translation: BAB08942.1
CP002688 Genomic DNA Translation: AED98292.1
CP002688 Genomic DNA Translation: AED98293.1
AY081304 mRNA Translation: AAL91193.1 Sequence problems.
AY093145 mRNA Translation: AAM13144.1
BT002560 mRNA Translation: AAO00920.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_201504.2, NM_126103.2 [Q9FGC7-2]
NP_851285.1, NM_180954.3 [Q9FGC7-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G67030.1; AT5G67030.1; AT5G67030 [Q9FGC7-1]
AT5G67030.2; AT5G67030.2; AT5G67030 [Q9FGC7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
836838

Gramene; a comparative resource for plants

More...
Gramenei
AT5G67030.1; AT5G67030.1; AT5G67030 [Q9FGC7-1]
AT5G67030.2; AT5G67030.2; AT5G67030 [Q9FGC7-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G67030

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB030296 mRNA Translation: BAB11935.1
AF134577 Genomic DNA Translation: AAF82390.1
AF134578 mRNA Translation: AAF82391.1
AF281655 mRNA Translation: AAG17703.1
AF283761 Genomic DNA Translation: AAG38877.1
AB026640 Genomic DNA Translation: BAB08942.1
CP002688 Genomic DNA Translation: AED98292.1
CP002688 Genomic DNA Translation: AED98293.1
AY081304 mRNA Translation: AAL91193.1 Sequence problems.
AY093145 mRNA Translation: AAM13144.1
BT002560 mRNA Translation: AAO00920.1 Sequence problems.
RefSeqiNP_201504.2, NM_126103.2 [Q9FGC7-2]
NP_851285.1, NM_180954.3 [Q9FGC7-1]

3D structure databases

SMRiQ9FGC7
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G67030.1

Proteomic databases

PaxDbiQ9FGC7
PRIDEiQ9FGC7
ProteomicsDBi242947 [Q9FGC7-1]

Genome annotation databases

EnsemblPlantsiAT5G67030.1; AT5G67030.1; AT5G67030 [Q9FGC7-1]
AT5G67030.2; AT5G67030.2; AT5G67030 [Q9FGC7-2]
GeneIDi836838
GrameneiAT5G67030.1; AT5G67030.1; AT5G67030 [Q9FGC7-1]
AT5G67030.2; AT5G67030.2; AT5G67030 [Q9FGC7-2]
KEGGiath:AT5G67030

Organism-specific databases

AraportiAT5G67030
TAIRilocus:2158083, AT5G67030

Phylogenomic databases

eggNOGiKOG2614, Eukaryota
HOGENOMiCLU_009665_16_1_1
InParanoidiQ9FGC7
OMAiIFGGWCD
OrthoDBi521070at2759
PhylomeDBiQ9FGC7

Enzyme and pathway databases

UniPathwayiUPA00090
BioCyciMetaCyc:AT5G67030-MONOMER
BRENDAi1.14.15.21, 399

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9FGC7

Gene expression databases

ExpressionAtlasiQ9FGC7, baseline and differential
GenevisibleiQ9FGC7, AT

Family and domain databases

CDDicd00060, FHA, 1 hit
Gene3Di3.50.50.60, 1 hit
InterProiView protein in InterPro
IPR002938, FAD-bd
IPR036188, FAD/NAD-bd_sf
IPR000253, FHA_dom
IPR008984, SMAD_FHA_dom_sf
IPR017079, Zeaxanthin_epoxidase
PfamiView protein in Pfam
PF01494, FAD_binding_3, 2 hits
PF00498, FHA, 1 hit
PIRSFiPIRSF036989, Zeaxanthin_epoxidase, 1 hit
SMARTiView protein in SMART
SM00240, FHA, 1 hit
SUPFAMiSSF49879, SSF49879, 1 hit
SSF51905, SSF51905, 1 hit
PROSITEiView protein in PROSITE
PS50006, FHA_DOMAIN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZEP_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FGC7
Secondary accession number(s): F4K278
, Q8RXE6, Q9FDX0, Q9FS21, Q9LDB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 27, 2011
Last sequence update: March 1, 2001
Last modified: June 2, 2021
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again