Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (22 Apr 2020)
Sequence version 2 (10 Aug 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NF-X1-type zinc finger protein NFXL2

Gene

NFXL2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcriptional regulator. May mediate E2- or E3-dependent ubiquitination. Required to gate light sensitivity during the night. Regulates the speed of the clock by acting in the feedback loop between CCA1, LHY and APRR1/TOC1. Promotes the expression of CCA1 at night but not by days. This activational effect is enhanced by interaction with ADO1/ZTL. Association with ADO1/ZTL is not leading to the degradation of NFXL2. Confers sensitivity to osmotic stress such as high salinity. Prevents H2O2 production and abscisic acid accumulation. Part of a regulatory network that integrates the biosynthesis and action of abscisic acid, reactive oxygen species and cuticle components.5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri87 – 152RING-type; degenerateAdd BLAST66
Zinc fingeri198 – 216NF-X1-type 1Add BLAST19
Zinc fingeri250 – 269NF-X1-type 2Add BLAST20
Zinc fingeri303 – 322NF-X1-type 3Add BLAST20
Zinc fingeri357 – 377NF-X1-type 4Add BLAST21
Zinc fingeri410 – 429NF-X1-type 5Add BLAST20
Zinc fingeri437 – 456NF-X1-type 6Add BLAST20
Zinc fingeri494 – 515NF-X1-type 7Add BLAST22
Zinc fingeri523 – 568NF-X1-type 8Add BLAST46
Zinc fingeri605 – 636NF-X1-type 9Add BLAST32
Zinc fingeri646 – 664NF-X1-type 10Add BLAST19
Zinc fingeri709 – 738NF-X1-type 11Add BLAST30

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processBiological rhythms, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NF-X1-type zinc finger protein NFXL2 (EC:2.3.2.-)
Short name:
AtNFXL2
Alternative name(s):
Protein EARLY BIRD
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NFXL2
Synonyms:EBI
Ordered Locus Names:At5g05660
ORF Names:MJJ3.6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT5G05660

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei841 – 863HelicalSequence analysisAdd BLAST23

Keywords - Cellular componenti

Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

No obvious morphological alterations. Enhanced growth and survival under water or salt stress. Enhanced H2O2 production. Elevated abscisic acid levels and reduced stomatal aperture.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi354V → I in ebi-1; altered circadian clock function. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003968361 – 883NF-X1-type zinc finger protein NFXL2Add BLAST883

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9FFK8

PRoteomics IDEntifications database

More...
PRIDEi
Q9FFK8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Constitutively expressed in mesophyll and guard cells.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Circadian-regulation with a peak of expression at or before dawn. Not regulated by biotic and abiotic stresses, by light and nutrient conditions or upon treatment with elicitors, chemicals, abscisic acid or phytohormones.2 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9FFK8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9FFK8 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ADO1/ZTL.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
15729, 2 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT5G05660.1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi28 – 86Ser-richAdd BLAST59
Compositional biasi186 – 738Cys-richAdd BLAST553

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-type zinc finger domain interacts with an ubiquitin-conjugating enzyme (E2) and facilitates ubiquitination.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NFX1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri87 – 152RING-type; degenerateAdd BLAST66
Zinc fingeri198 – 216NF-X1-type 1Add BLAST19
Zinc fingeri250 – 269NF-X1-type 2Add BLAST20
Zinc fingeri303 – 322NF-X1-type 3Add BLAST20
Zinc fingeri357 – 377NF-X1-type 4Add BLAST21
Zinc fingeri410 – 429NF-X1-type 5Add BLAST20
Zinc fingeri437 – 456NF-X1-type 6Add BLAST20
Zinc fingeri494 – 515NF-X1-type 7Add BLAST22
Zinc fingeri523 – 568NF-X1-type 8Add BLAST46
Zinc fingeri605 – 636NF-X1-type 9Add BLAST32
Zinc fingeri646 – 664NF-X1-type 10Add BLAST19
Zinc fingeri709 – 738NF-X1-type 11Add BLAST30

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1952 Eukaryota
ENOG410XR02 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014224_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9FFK8

KEGG Orthology (KO)

More...
KOi
K15683

Identification of Orthologs from Complete Genome Data

More...
OMAi
FLVPHSC

Database of Orthologous Groups

More...
OrthoDBi
299100at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034078 NFX1_fam
IPR019786 Zinc_finger_PHD-type_CS
IPR000967 Znf_NFX1

The PANTHER Classification System

More...
PANTHERi
PTHR12360 PTHR12360, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01422 zf-NF-X1, 12 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00438 ZnF_NFX, 11 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00197 2FE2S_FER_1, 2 hits
PS01359 ZF_PHD_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform NFXL2-97 (identifier: Q9FFK8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTNMAGTATT EFRWKSPPQP PSQEQPISDS DSDSGSDSEN HQHRHNDLSN
60 70 80 90 100
SIFEAYLDCH SSSSPSSIDL AKIQSFLASS SSGAVSCLIC LERIKRTDPT
110 120 130 140 150
WSCTSSCFAV FHLFCIQSWA RQCLDLQAAR AVTRPSSNPT EPEAVWNCPK
160 170 180 190 200
CRSSYQKSKI PRRYLCYCGK EEDPPADNPW ILPHSCGEVC ERPLSNNCGH
210 220 230 240 250
CCLLLCHPGP CASCPKLVKA KCFCGGVEDV RRCGHKQFSC GDVCERVLDC
260 270 280 290 300
NIHNCREICH DGECPPCRER AVYKCSCGKV KEEKDCCERV FRCEASCENM
310 320 330 340 350
LNCGKHVCER GCHAGECGLC PYQGKRSCPC GKRFYQGLSC DVVAPLCGGT
360 370 380 390 400
CDKVLGCGYH RCPERCHRGP CLETCRIVVT KSCRCGVTKK QVPCHQELAC
410 420 430 440 450
ERKCQRVRDC ARHACRRRCC DGECPPCSEI CGKKLRCRNH KCQSPCHQGP
460 470 480 490 500
CAPCPIMVTI SCACGETHFE VPCGTETNQK PPRCRKLCHI TPLCRHGQNQ
510 520 530 540 550
KPHKCHYGAC PPCRLLCDEE YPCGHKCKLR CHGPRPPPNR EFILKPTKKM
560 570 580 590 600
LHIQAESTPG SPCPRCPEPV WRPCVGHHLA AEKRMICSDR TQFACDNLCG
610 620 630 640 650
NPLPCGNHYC SYFCHALDIR SSSLDKRSES CEKCDLRCQK ERTPRCQHPC
660 670 680 690 700
PRRCHPEDCP PCKTLVKRSC HCGAMVHAFE CIYYNTMSEK DQMKARSCRG
710 720 730 740 750
PCHRKLPNCT HLCPEICHPG QCPLPEKCGK KVVVRCKCLT LKKEWVCQDV
760 770 780 790 800
QAAHRATGSD PKEVPKNQFG VGLLPCDSNC KSKLQVAESV LTQRNVKEIE
810 820 830 840 850
EKEEPSGKNA SKRRKRRGRG QDIQETTRLQ KLAVTTKRIL MVVMLVAMLA
860 870 880
AVSYYGYKGL LWLSDWMNEV EEQRQKSRRY PRI
Length:883
Mass (Da):99,229
Last modified:August 10, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65CA28E09D161CB7
GO
Isoform NFXL2-100 (identifier: Q9FFK8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     730-730: K → KKVSICQFISIWDAVSVTSEILLVSILSWI

Show »
Length:912
Mass (Da):102,462
Checksum:i47AF1D0F8062689A
GO
Isoform NFXL2-78 (identifier: Q9FFK8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     698-714: CRGPCHRKLPNCTHLCP → SLVIPTVRANYRWLNRC
     715-883: Missing.

Show »
Length:714
Mass (Da):80,059
Checksum:i00D68B754FE59610
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AK228690 differs from that shown. Reason: Frameshift.Curated
The sequence BAB09660 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti270R → H no nucleotide entry (PubMed:22073231).Curated1
Sequence conflicti466E → G in AK228690 (Ref. 4) Curated1
Sequence conflicti552H → N no nucleotide entry (PubMed:22073231).Curated1
Sequence conflicti660P → L no nucleotide entry (PubMed:22073231).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046010698 – 714CRGPC…THLCP → SLVIPTVRANYRWLNRC in isoform NFXL2-78. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_046011715 – 883Missing in isoform NFXL2-78. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_046012730K → KKVSICQFISIWDAVSVTSE ILLVSILSWI in isoform NFXL2-100. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB005237 Genomic DNA Translation: BAB09660.1 Sequence problems.
CP002688 Genomic DNA Translation: AED90905.2
AK228690 mRNA No translation available.

NCBI Reference Sequences

More...
RefSeqi
NP_196185.4, NM_120648.6 [Q9FFK8-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT5G05660.1; AT5G05660.1; AT5G05660 [Q9FFK8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
830450

Gramene; a comparative resource for plants

More...
Gramenei
AT5G05660.1; AT5G05660.1; AT5G05660 [Q9FFK8-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT5G05660

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB005237 Genomic DNA Translation: BAB09660.1 Sequence problems.
CP002688 Genomic DNA Translation: AED90905.2
AK228690 mRNA No translation available.
RefSeqiNP_196185.4, NM_120648.6 [Q9FFK8-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi15729, 2 interactors
STRINGi3702.AT5G05660.1

Proteomic databases

PaxDbiQ9FFK8
PRIDEiQ9FFK8

Genome annotation databases

EnsemblPlantsiAT5G05660.1; AT5G05660.1; AT5G05660 [Q9FFK8-1]
GeneIDi830450
GrameneiAT5G05660.1; AT5G05660.1; AT5G05660 [Q9FFK8-1]
KEGGiath:AT5G05660

Organism-specific databases

AraportiAT5G05660

Phylogenomic databases

eggNOGiKOG1952 Eukaryota
ENOG410XR02 LUCA
HOGENOMiCLU_014224_0_0_1
InParanoidiQ9FFK8
KOiK15683
OMAiFLVPHSC
OrthoDBi299100at2759

Enzyme and pathway databases

UniPathwayiUPA00143

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9FFK8

Gene expression databases

ExpressionAtlasiQ9FFK8 baseline and differential
GenevisibleiQ9FFK8 AT

Family and domain databases

InterProiView protein in InterPro
IPR034078 NFX1_fam
IPR019786 Zinc_finger_PHD-type_CS
IPR000967 Znf_NFX1
PANTHERiPTHR12360 PTHR12360, 1 hit
PfamiView protein in Pfam
PF01422 zf-NF-X1, 12 hits
SMARTiView protein in SMART
SM00438 ZnF_NFX, 11 hits
PROSITEiView protein in PROSITE
PS00197 2FE2S_FER_1, 2 hits
PS01359 ZF_PHD_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFXL2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9FFK8
Secondary accession number(s): F4K0S4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 10, 2010
Last sequence update: August 10, 2010
Last modified: April 22, 2020
This is version 115 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again