Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Espin

Gene

Espn

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimension, dynamics and signaling capacities of the actin filament-rich microvilli in the mechanosensory and chemosensory cells (PubMed:14657236, PubMed:15190118). Required for the assembly and stabilization of the stereociliary parallel actin bundles. Plays a crucial role in the formation and maintenance of inner ear hair cell stereocilia (PubMed:21455486). Involved in the elongation of actin in stereocilia (PubMed:19287378, PubMed:22264607). In extrastriolar hair cells, required for targeting MYO3B to stereocilia tips, and for regulation of stereocilia diameter and staircase formation (PubMed:26926603).6 Publications

Miscellaneous

Jerker mice have a frameshift mutation that affect the espin C-terminus. This mutation cause deafness, vestibular dysfunction and hair cell degeneration.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • actin filament bundle assembly Source: MGI
  • actin filament network formation Source: UniProtKB
  • locomotory behavior Source: MGI
  • negative regulation of cytoskeleton organization Source: UniProtKB
  • parallel actin filament bundle assembly Source: MGI
  • positive regulation of filopodium assembly Source: MGI
  • sensory perception of sound Source: UniProtKB-KW

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
Biological processHearing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Espin
Alternative name(s):
Ectoplasmic specialization protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Espn
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1861630 Espn

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003346671 – 871EspinAdd BLAST871

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei338PhosphoserineBy similarity1
Modified residuei342PhosphoserineCombined sources1
Modified residuei517PhosphoserineBy similarity1
Modified residuei524PhosphoserineBy similarity1
Modified residuei556PhosphoserineBy similarity1
Modified residuei665PhosphoserineCombined sources1
Modified residuei704PhosphoserineCombined sources1
Modified residuei708PhosphoserineCombined sources1
Modified residuei714PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ET47

PRoteomics IDEntifications database

More...
PRIDEi
Q9ET47

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ET47

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ET47

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high concentration in the microvillar parallel actin bundle (PAB) of hair cells stereocilia in the cochlea and vestibular system. Detected also at high levels of a number of other sensory cell types, including taste receptor cells, solitary chemoreceptor cells, vomeronasal sensory neurons and Merkel cells. Isoforms 2, 3, 4 and 5 are expressed in Purkinje cells dendritic spines. Expressed in utricle hair bundles (at protein level) (PubMed:26926603).4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028943 Expressed in 98 organ(s), highest expression level in intestinal villus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ET47 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ET47 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (Probable). Binds F-actin in a Ca2+-resistant fashion (PubMed:10588661). Interacts (via N-terminus) with BAIAP2 (via SH3-domain) (PubMed:12598619). Interacts with PFN2 (PubMed:15190118). Interacts with MYO3A (via C-terminus) (PubMed:26926603). Interacts with MYO3B (via C-terminus) (PubMed:26926603, PubMed:26785147).Curated5 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
207859, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q9ET47, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9ET47

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000030785

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1871
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9ET47

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ET47

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 31ANK 1Add BLAST31
Repeati35 – 66ANK 2Add BLAST32
Repeati69 – 99ANK 3Add BLAST31
Repeati103 – 132ANK 4Add BLAST30
Repeati137 – 167ANK 5Add BLAST31
Repeati171 – 201ANK 6Add BLAST31
Repeati205 – 235ANK 7Add BLAST31
Repeati239 – 268ANK 8Add BLAST30
Repeati271 – 300ANK 9Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini669 – 686WH2PROSITE-ProRule annotationAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili772 – 848Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi428 – 465Pro-richAdd BLAST38
Compositional biasi607 – 629Pro-richAdd BLAST23
Compositional biasi642 – 645Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The WH2-domain binds actin monomer and mediates actin bundle assembly.1 Publication

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160408

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG100662

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ET47

Identification of Orthologs from Complete Genome Data

More...
OMAi
YYKALGS

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ET47

TreeFam database of animal gene trees

More...
TreeFami
TF326392

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR030233 Espn
IPR003124 WH2_dom

The PANTHER Classification System

More...
PANTHERi
PTHR24153:SF14 PTHR24153:SF14, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 2 hits
PF02205 WH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 9 hits
SM00246 WH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS51082 WH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ET47-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALEQALQAA RRGDLDVLRS LHAAGLLGPS LRDSLDALPV HHAARSGKLH
60 70 80 90 100
CLRYLVEEVA LPAVSRARNG ATPAHDAAAT GYLSCLQWLL TQGGCRVQEK
110 120 130 140 150
DNSGATVLHL AARFGHPDVV KWLLYQGGAN SAITTDTGAL PIHYAAAKGD
160 170 180 190 200
LPSLKLLVGH YPEGVNAQTN NGATPLYLAC QEGHLEVTKY LVQECSADPH
210 220 230 240 250
LRAQDGMTPL HAAAQMGHNP VLVWLVSFAD VSFSEQDHDG ATAMHFAASR
260 270 280 290 300
GHTKVLSWLL LHGAEISQDL WGGTPLHDAA ENGELECCQI LAVNGAGLDV
310 320 330 340 350
RDHDGYTAAD LAEFNGHTHC SRYLRTVQTL SLEHRVLSRD QSMDLEAKQL
360 370 380 390 400
DSGMSSPNTT MSVQPMTFDL GSPTSTFSNY DSCSSSHSSS KGQRSNRGIP
410 420 430 440 450
GARAADLQSY MDMLNPEKSL PRGKLGKPSP PPPPPPPPPS FPPPPPPTGT
460 470 480 490 500
QPPPPPPGYP APNPPVGLHL NNIYMQTKNK LRHVEVDSLK EPKVELNDQF
510 520 530 540 550
AQPSSGDGHS GLHRQDSGLL RQDSELLHRQ ELLRHSTGLR RQDSDRKQRS
560 570 580 590 600
FSKQPSTGDY YRQLGRSPGE PLAARPGMAH SEEAALLPGN HVHNGCSADS
610 620 630 640 650
KASRELPPPP PPPPLPEALS SPPPAPPLPI EGAGAACGQR RSSSSTGKVR
660 670 680 690 700
VLRHRKSTKS FNMMSPTGDN SELLAEIKAG KSLKPTPQSK GLTTVFSGSG
710 720 730 740 750
QPASQPESPQ PLVSPAPSRT RSPTPPASGS QPLLNGSVVP APPATPAPGV
760 770 780 790 800
HLDVEALIPT LDEQGRPIPE WKRQVMVRKL QQKMQEEEEQ RRKEEEEEAR
810 820 830 840 850
LASLPAWRRD ILRKKLEEER EQKRKEEERQ KLEEIQRAKE QSEKLRTLGY
860 870
DEAKLAPWQR QVILKKGEIP K
Length:871
Mass (Da):94,497
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC7707D5C73678DA1
GO
Isoform 2 (identifier: Q9ET47-2) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-502: Missing.
     648-656: Missing.

Show »
Length:524
Mass (Da):57,110
Checksum:i1E8E73310C9FF73A
GO
Isoform 3 (identifier: Q9ET47-3) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 1+

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-502: Missing.

Show »
Length:533
Mass (Da):58,284
Checksum:iB6C766CA2E809B12
GO
Isoform 4 (identifier: Q9ET47-4) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 2+

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-583: Missing.

Show »
Length:452
Mass (Da):49,195
Checksum:i6BF7A17610ADB308
GO
Isoform 5 (identifier: Q9ET47-5) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin isoform 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-327: Missing.
     328-330: QTL → MGN
     492-583: Missing.
     648-656: Missing.

Show »
Length:443
Mass (Da):48,021
Checksum:iC1E65EA9DF270594
GO
Isoform 6 (identifier: Q9ET47-6) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     1-547: Missing.
     548-583: QRSFSKQPSTGDYYRQLGRSPGEPLAARPGMAHSEE → MAHSEEVRVHQPALAGCSGPSPVPRPSLSGPSAPPQ
     648-656: Missing.

Show »
Length:315
Mass (Da):34,039
Checksum:i881DAD36A6CC0FCF
GO
Isoform 7 (identifier: Q9ET47-7) [UniParc]FASTAAdd to basket
Also known as: 3A

The sequence of this isoform differs from the canonical sequence as follows:
     1-577: Missing.
     648-656: Missing.

Show »
Length:285
Mass (Da):31,109
Checksum:i8F41844768B6884D
GO
Isoform 8 (identifier: Q9ET47-8) [UniParc]FASTAAdd to basket
Also known as: small

The sequence of this isoform differs from the canonical sequence as follows:
     1-643: Missing.
     644-656: SSTGKVRVLRHRK → MNSQGPLGGGRIP
     705-705: Q → QVGTGRVPRPGSQCLPSAQPYCFSRQ

Show »
Length:253
Mass (Da):28,116
Checksum:iC7AE5E342801385C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AWQ3B1AWQ3_MOUSE
Espin
Espn
848Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWQ1B1AWQ1_MOUSE
Espin
Espn
700Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWQ4B1AWQ4_MOUSE
Espin
Espn
881Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LJB0A0A140LJB0_MOUSE
Espin
Espn
1,405Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWP7B1AWP7_MOUSE
Espin
Espn
449Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWP8B1AWP8_MOUSE
Espin
Espn
530Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWP9B1AWP9_MOUSE
Espin
Espn
440Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9DD12Q9DD12_MOUSE
Espin
Espn
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AWQ0B1AWQ0_MOUSE
Espin
Espn
521Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti564L → M in AAO50326 (PubMed:12598619).Curated1
Sequence conflicti564L → M in AAO50327 (PubMed:12598619).Curated1
Sequence conflicti564L → M in AAF98134 (PubMed:10975527).Curated1
Sequence conflicti720T → A in AAF18322 (PubMed:10588661).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0337301 – 643Missing in isoform 8. CuratedAdd BLAST643
Alternative sequenceiVSP_0337311 – 577Missing in isoform 7. 1 PublicationAdd BLAST577
Alternative sequenceiVSP_0337321 – 547Missing in isoform 6. 1 PublicationAdd BLAST547
Alternative sequenceiVSP_0337331 – 327Missing in isoform 2, isoform 4, isoform 3 and isoform 5. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_033734328 – 330QTL → MGN in isoform 2, isoform 4, isoform 3 and isoform 5. 1 Publication3
Alternative sequenceiVSP_033735492 – 583Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST92
Alternative sequenceiVSP_033736492 – 502Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_033737548 – 583QRSFS…AHSEE → MAHSEEVRVHQPALAGCSGP SPVPRPSLSGPSAPPQ in isoform 6. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033738644 – 656SSTGK…LRHRK → MNSQGPLGGGRIP in isoform 8. CuratedAdd BLAST13
Alternative sequenceiVSP_033739648 – 656Missing in isoform 2, isoform 5, isoform 6 and isoform 7. 2 Publications9
Alternative sequenceiVSP_033740705Q → QVGTGRVPRPGSQCLPSAQP YCFSRQ in isoform 8. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF239886 mRNA Translation: AAF98134.1
AF540942 mRNA Translation: AAO50326.1
AF540943 mRNA Translation: AAO50327.1
AF540944 mRNA Translation: AAO50328.1
AF540945 mRNA Translation: AAO50329.1
AY587570 mRNA Translation: AAT46472.1
AY587571 mRNA Translation: AAT46473.1
AF134858 Genomic DNA Translation: AAF18322.1
AL772240 Genomic DNA Translation: CAM19680.1
AL772240 Genomic DNA Translation: CAM19684.1
AL772240 Genomic DNA Translation: CAM19685.1
AL772240 Genomic DNA Translation: CAM19686.1
AL772240 Genomic DNA Translation: CAM19687.1
AL772240 Genomic DNA Translation: CAM19691.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18989.1 [Q9ET47-1]
CCDS18990.1 [Q9ET47-3]
CCDS18991.1 [Q9ET47-4]
CCDS18992.1 [Q9ET47-5]
CCDS18993.1 [Q9ET47-2]
CCDS18994.1 [Q9ET47-8]

NCBI Reference Sequences

More...
RefSeqi
NP_997570.1, NM_207687.2 [Q9ET47-1]
NP_997571.1, NM_207688.2 [Q9ET47-3]
NP_997572.1, NM_207689.2 [Q9ET47-4]
NP_997573.1, NM_207690.2 [Q9ET47-5]
NP_997574.2, NM_207691.2 [Q9ET47-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.264215

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000030785; ENSMUSP00000030785; ENSMUSG00000028943 [Q9ET47-1]
ENSMUST00000070018; ENSMUSP00000065545; ENSMUSG00000028943 [Q9ET47-2]
ENSMUST00000080042; ENSMUSP00000078951; ENSMUSG00000028943 [Q9ET47-4]
ENSMUST00000084114; ENSMUSP00000081131; ENSMUSG00000028943 [Q9ET47-3]
ENSMUST00000105653; ENSMUSP00000101278; ENSMUSG00000028943 [Q9ET47-7]
ENSMUST00000105657; ENSMUSP00000101282; ENSMUSG00000028943 [Q9ET47-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56226

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56226

UCSC genome browser

More...
UCSCi
uc008vzn.1 mouse [Q9ET47-6]
uc008vzo.1 mouse [Q9ET47-7]
uc008vzp.1 mouse [Q9ET47-4]
uc008vzq.1 mouse [Q9ET47-3]
uc008vzr.1 mouse [Q9ET47-5]
uc008vzs.1 mouse [Q9ET47-2]
uc008vzt.1 mouse [Q9ET47-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF239886 mRNA Translation: AAF98134.1
AF540942 mRNA Translation: AAO50326.1
AF540943 mRNA Translation: AAO50327.1
AF540944 mRNA Translation: AAO50328.1
AF540945 mRNA Translation: AAO50329.1
AY587570 mRNA Translation: AAT46472.1
AY587571 mRNA Translation: AAT46473.1
AF134858 Genomic DNA Translation: AAF18322.1
AL772240 Genomic DNA Translation: CAM19680.1
AL772240 Genomic DNA Translation: CAM19684.1
AL772240 Genomic DNA Translation: CAM19685.1
AL772240 Genomic DNA Translation: CAM19686.1
AL772240 Genomic DNA Translation: CAM19687.1
AL772240 Genomic DNA Translation: CAM19691.1
CCDSiCCDS18989.1 [Q9ET47-1]
CCDS18990.1 [Q9ET47-3]
CCDS18991.1 [Q9ET47-4]
CCDS18992.1 [Q9ET47-5]
CCDS18993.1 [Q9ET47-2]
CCDS18994.1 [Q9ET47-8]
RefSeqiNP_997570.1, NM_207687.2 [Q9ET47-1]
NP_997571.1, NM_207688.2 [Q9ET47-3]
NP_997572.1, NM_207689.2 [Q9ET47-4]
NP_997573.1, NM_207690.2 [Q9ET47-5]
NP_997574.2, NM_207691.2 [Q9ET47-2]
UniGeneiMm.264215

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5ET0X-ray2.30A/C1-352[»]
5ET1X-ray1.65A/B1-352[»]
ProteinModelPortaliQ9ET47
SMRiQ9ET47
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207859, 8 interactors
IntActiQ9ET47, 9 interactors
MINTiQ9ET47
STRINGi10090.ENSMUSP00000030785

PTM databases

iPTMnetiQ9ET47
PhosphoSitePlusiQ9ET47

Proteomic databases

PaxDbiQ9ET47
PRIDEiQ9ET47

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030785; ENSMUSP00000030785; ENSMUSG00000028943 [Q9ET47-1]
ENSMUST00000070018; ENSMUSP00000065545; ENSMUSG00000028943 [Q9ET47-2]
ENSMUST00000080042; ENSMUSP00000078951; ENSMUSG00000028943 [Q9ET47-4]
ENSMUST00000084114; ENSMUSP00000081131; ENSMUSG00000028943 [Q9ET47-3]
ENSMUST00000105653; ENSMUSP00000101278; ENSMUSG00000028943 [Q9ET47-7]
ENSMUST00000105657; ENSMUSP00000101282; ENSMUSG00000028943 [Q9ET47-5]
GeneIDi56226
KEGGimmu:56226
UCSCiuc008vzn.1 mouse [Q9ET47-6]
uc008vzo.1 mouse [Q9ET47-7]
uc008vzp.1 mouse [Q9ET47-4]
uc008vzq.1 mouse [Q9ET47-3]
uc008vzr.1 mouse [Q9ET47-5]
uc008vzs.1 mouse [Q9ET47-2]
uc008vzt.1 mouse [Q9ET47-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83715
MGIiMGI:1861630 Espn

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000160408
HOVERGENiHBG100662
InParanoidiQ9ET47
OMAiYYKALGS
PhylomeDBiQ9ET47
TreeFamiTF326392

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9ET47

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028943 Expressed in 98 organ(s), highest expression level in intestinal villus
ExpressionAtlasiQ9ET47 baseline and differential
GenevisibleiQ9ET47 MM

Family and domain databases

CDDicd00204 ANK, 4 hits
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR030233 Espn
IPR003124 WH2_dom
PANTHERiPTHR24153:SF14 PTHR24153:SF14, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF02205 WH2, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 9 hits
SM00246 WH2, 1 hit
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 6 hits
PS51082 WH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiESPN_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ET47
Secondary accession number(s): A2AK06
, A2AK09, A2AK13, B1AWP3, B1AWP6, B1AWQ2, Q6GYS0, Q6GYS1, Q80ZC0, Q80ZC1, Q80ZC2, Q80ZC3, Q9QY27
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: December 5, 2018
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again