Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein K

Gene

Cenpk

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with KNL1 to recruit the NDC80 complex to the outer kinetochore (By similarity).By similarity

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-MMU-68877 Mitotic Prometaphase

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein K
Short name:
CENP-K
Alternative name(s):
SoxLZ/Sox6 leucine zipper-binding protein in testis
Gene namesi
Name:Cenpk
Synonyms:Solt
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1926210 Cenpk

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002494831 – 271Centromere protein KAdd BLAST271

Proteomic databases

PaxDbiQ9ESN5
PeptideAtlasiQ9ESN5
PRIDEiQ9ESN5

PTM databases

iPTMnetiQ9ESN5
PhosphoSitePlusiQ9ESN5

Expressioni

Tissue specificityi

Highly expressed in testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000021714 Expressed in 206 organ(s), highest expression level in ureter smooth muscle
CleanExiMM_CENPK
ExpressionAtlasiQ9ESN5 baseline and differential

Interactioni

Subunit structurei

Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. May interact with Sox6.

Protein-protein interaction databases

IntActiQ9ESN5, 1 interactor
MINTiQ9ESN5
STRINGi10090.ENSMUSP00000022227

Structurei

3D structure databases

SMRiQ9ESN5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili11 – 44Sequence analysisAdd BLAST34
Coiled coili102 – 151Sequence analysisAdd BLAST50

Sequence similaritiesi

Belongs to the CENP-K/MCM22 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGKP Eukaryota
ENOG4111ZR6 LUCA
GeneTreeiENSGT00390000006243
HOGENOMiHOG000111542
HOVERGENiHBG081084
InParanoidiQ9ESN5
KOiK11503
PhylomeDBiQ9ESN5
TreeFamiTF333264

Family and domain databases

InterProiView protein in InterPro
IPR020993 Centromere_CenpK
PANTHERiPTHR14401 PTHR14401, 1 hit
PfamiView protein in Pfam
PF11802 CENP-K, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9ESN5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSENKQEVHP DTITDVEAVI DTEEELIKEC EEMWKDMEDC QNKLSLIGTE
60 70 80 90 100
TLTNADAQLS LLIMQMKCLT AELGQWKKRK PEIIPLNEDV LLTLGKEEFQ
110 120 130 140 150
KLRCDLEMVL STIQSKNEKL KEDLEREQQW LDEQQQILDT LNVLNSDVEN
160 170 180 190 200
QVVTLTESRI FNELTTKIRG IKEFKEKLLL TLGAFLDNHF PLPEASTPKK
210 220 230 240 250
RKNIQDSNAQ LITLNEILEM LINRMFDVPH DPYVKIRDSF WPPYIELLLR
260 270
YGIALRHPED PSQIRLEAFH Q
Length:271
Mass (Da):31,686
Last modified:September 19, 2006 - v2
Checksum:i0805A7930078B014
GO
Isoform 2 (identifier: Q9ESN5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-271: MLINRMFDVP...SQIRLEAFHQ → VPLRAMGSTLESCWFPRETLLEEAAFSLASASVG

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):28,978
Checksum:i066A7EF2AB4DD2DD
GO
Isoform 3 (identifier: Q9ESN5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
     266-271: LEAFHQ → TSCMVGACGDQKSHH

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):20,140
Checksum:iEA4651E29E5F58A7
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J037A0A0R4J037_MOUSE
Centromere protein K
Cenpk mCG_17230
306Annotation score:
A0A286YDG4A0A286YDG4_MOUSE
Centromere protein K
Cenpk
94Annotation score:
A0A286YE26A0A286YE26_MOUSE
Centromere protein K
Cenpk
91Annotation score:

Sequence cautioni

The sequence AAH92351 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAB16367 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti115S → T in AAH92351 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0204371 – 107Missing in isoform 3. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_020438220 – 271MLINR…EAFHQ → VPLRAMGSTLESCWFPRETL LEEAAFSLASASVG in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_020439266 – 271LEAFHQ → TSCMVGACGDQKSHH in isoform 3. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB043687 mRNA Translation: BAB16367.1 Different initiation.
AK082939 mRNA Translation: BAC38702.1
AK135773 mRNA Translation: BAE22654.1
BC092351 mRNA Translation: AAH92351.1 Sequence problems.
CCDSiCCDS26750.1 [Q9ESN5-2]
RefSeqiNP_068562.1, NM_021790.2
NP_851406.1, NM_181061.5 [Q9ESN5-2]
XP_017171041.1, XM_017315552.1 [Q9ESN5-1]
XP_017171042.1, XM_017315553.1 [Q9ESN5-1]
UniGeneiMm.281498

Genome annotation databases

EnsembliENSMUST00000070761; ENSMUSP00000070910; ENSMUSG00000021714 [Q9ESN5-2]
GeneIDi60411
KEGGimmu:60411
UCSCiuc007rtc.2 mouse [Q9ESN5-2]
uc007rtd.2 mouse [Q9ESN5-1]
uc007rtf.1 mouse [Q9ESN5-3]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB043687 mRNA Translation: BAB16367.1 Different initiation.
AK082939 mRNA Translation: BAC38702.1
AK135773 mRNA Translation: BAE22654.1
BC092351 mRNA Translation: AAH92351.1 Sequence problems.
CCDSiCCDS26750.1 [Q9ESN5-2]
RefSeqiNP_068562.1, NM_021790.2
NP_851406.1, NM_181061.5 [Q9ESN5-2]
XP_017171041.1, XM_017315552.1 [Q9ESN5-1]
XP_017171042.1, XM_017315553.1 [Q9ESN5-1]
UniGeneiMm.281498

3D structure databases

SMRiQ9ESN5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9ESN5, 1 interactor
MINTiQ9ESN5
STRINGi10090.ENSMUSP00000022227

PTM databases

iPTMnetiQ9ESN5
PhosphoSitePlusiQ9ESN5

Proteomic databases

PaxDbiQ9ESN5
PeptideAtlasiQ9ESN5
PRIDEiQ9ESN5

Protocols and materials databases

DNASUi60411
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000070761; ENSMUSP00000070910; ENSMUSG00000021714 [Q9ESN5-2]
GeneIDi60411
KEGGimmu:60411
UCSCiuc007rtc.2 mouse [Q9ESN5-2]
uc007rtd.2 mouse [Q9ESN5-1]
uc007rtf.1 mouse [Q9ESN5-3]

Organism-specific databases

CTDi64105
MGIiMGI:1926210 Cenpk

Phylogenomic databases

eggNOGiENOG410IGKP Eukaryota
ENOG4111ZR6 LUCA
GeneTreeiENSGT00390000006243
HOGENOMiHOG000111542
HOVERGENiHBG081084
InParanoidiQ9ESN5
KOiK11503
PhylomeDBiQ9ESN5
TreeFamiTF333264

Enzyme and pathway databases

ReactomeiR-MMU-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-MMU-2467813 Separation of Sister Chromatids
R-MMU-2500257 Resolution of Sister Chromatid Cohesion
R-MMU-5663220 RHO GTPases Activate Formins
R-MMU-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-MMU-68877 Mitotic Prometaphase

Miscellaneous databases

PROiPR:Q9ESN5
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021714 Expressed in 206 organ(s), highest expression level in ureter smooth muscle
CleanExiMM_CENPK
ExpressionAtlasiQ9ESN5 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR020993 Centromere_CenpK
PANTHERiPTHR14401 PTHR14401, 1 hit
PfamiView protein in Pfam
PF11802 CENP-K, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCENPK_MOUSE
AccessioniPrimary (citable) accession number: Q9ESN5
Secondary accession number(s): Q3UXA9, Q569Q3, Q8C469
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: October 10, 2018
This is version 107 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again