Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (02 Dec 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Adhesion G protein-coupled receptor L4

Gene

Adgrl4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Endothelial orphan receptor that acts as a key regulator of angiogenesis.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
LigandCalcium

Protein family/group databases

MEROPS protease database

More...
MEROPSi
P02.013

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L4
Alternative name(s):
EGF,latrophilin and seven transmembrane domain-containing protein 1
EGF-TM7-latrophilin-related protein
Short name:
ETL protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Adgrl4
Synonyms:Eltd1, Etl
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Rat genome database

More...
RGDi
621136, Adgrl4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 480ExtracellularCuratedAdd BLAST461
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei481 – 501Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini502 – 522CytoplasmicCuratedAdd BLAST21
Transmembranei523 – 543Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini544 – 547ExtracellularCurated4
Transmembranei548 – 568Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini569 – 580CytoplasmicCuratedAdd BLAST12
Transmembranei581 – 601Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini602 – 621ExtracellularCuratedAdd BLAST20
Transmembranei622 – 642Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini643 – 666CytoplasmicCuratedAdd BLAST24
Transmembranei667 – 687Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini688 – 694ExtracellularCurated7
Transmembranei695 – 715Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini716 – 738CytoplasmicCuratedAdd BLAST23

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi455T → A: Abolishes cleavage. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001287220 – 738Adhesion G protein-coupled receptor L4Add BLAST719

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi22 ↔ 32PROSITE-ProRule annotation
Disulfide bondi26 ↔ 41PROSITE-ProRule annotation
Disulfide bondi43 ↔ 55PROSITE-ProRule annotation
Disulfide bondi61 ↔ 73PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi62N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi67 ↔ 82PROSITE-ProRule annotation
Disulfide bondi84 ↔ 105PROSITE-ProRule annotation
Disulfide bondi111 ↔ 123PROSITE-ProRule annotation
Glycosylationi112N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi117 ↔ 132PROSITE-ProRule annotation
Disulfide bondi134 ↔ 155PROSITE-ProRule annotation
Glycosylationi175N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi226N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi297N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi421N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi429N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi443N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.1 Publication
Glycosylated.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei454 – 455Cleavage1 Publication2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ESC1

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9ESC1, 8 sites

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ESC1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in heart, lung, and kidney. Less evident expression is observed in brain, skeletal muscle, liver and spleen. No expression is detected in testis.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Up-regulated in the adult heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000033940, Expressed in brain and 21 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ESC1, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of 2 chains generated by proteolytic processing; the large extracellular N-terminal fragment and the membrane-bound C-terminal fragment predominantly remain associated and non-covalently linked.

1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000045890

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ESC1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 56EGF-like 1PROSITE-ProRule annotationAdd BLAST37
Domaini57 – 106EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST50
Domaini107 – 156EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST50
Domaini414 – 466GPSPROSITE-ProRule annotationAdd BLAST53

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The transmembrane domain is not required for cleavage, but it is required for dimer formation.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4193, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158252

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ESC1

Identification of Orthologs from Complete Genome Data

More...
OMAi
SQCAFWN

Database of Orthologous Groups

More...
OrthoDBi
388923at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ESC1

TreeFam database of animal gene trees

More...
TreeFami
TF316380

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR032471, GAIN_dom_N
IPR017981, GPCR_2-like
IPR000832, GPCR_2_secretin-like
IPR017983, GPCR_2_secretin-like_CS
IPR000203, GPS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002, 7tm_2, 1 hit
PF07645, EGF_CA, 2 hits
PF16489, GAIN, 1 hit
PF01825, GPS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00249, GPCRSECRETIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181, EGF, 3 hits
SM00179, EGF_CA, 2 hits
SM00303, GPS, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010, ASX_HYDROXYL, 2 hits
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 3 hits
PS01187, EGF_CA, 2 hits
PS00650, G_PROTEIN_RECEP_F2_2, 1 hit
PS50261, G_PROTEIN_RECEP_F2_4, 1 hit
PS50221, GPS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9ESC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLLLLLVGL STLLNHSYTQ NCKTPCLPNA KCEVLDEVAA CFCSTGYTGN
60 70 80 90 100
GITICEDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
110 120 130 140 150
DGSYCQDVDE CNETSVCGDH AVCENTNGGF SCFCVEGYQT STGKTQFTPN
160 170 180 190 200
DGSYCQEIVN SNCHLEHDCI AANINKTLKR IGPITEQLTL LHEIYKNSEA
210 220 230 240 250
ELSLVDIVTY IEILTESSSL QGYIKNTTSP KDAYFGSALT EFGKTVNNFV
260 270 280 290 300
EKNTHEMWDQ LPTNRRRLHL TKLMHAAEHV TLQISQNIQK NTQFDMNSTD
310 320 330 340 350
LALKVFVFDS VHMKHTHPHM NVDGGYVKIS PRRKSAYDPN GNVIVAFLCY
360 370 380 390 400
RSIGPLLSSS DDFLLGAQSD NSKGKEKVIS SVISASISSN PPTLYELEKI
410 420 430 440 450
TFTLSHVKLS DKHQTQCAFW NYSVDDMNNG SWSSEGCELT YSNDTHTSCR
460 470 480 490 500
CSHLTHFAIL MSPSTSIEVK DYNILTRITQ LGIIISLICL AICIFTFWFF
510 520 530 540 550
SEIQSTRTTI HKNLCCSLFL AQLVFLVGIN INTNKLVCSI IAGLLHYFFL
560 570 580 590 600
AAFAWMCIEG IYLYLIVVGL IYNKGFLHKN FYIFGYLSPA VVVGFSASLG
610 620 630 640 650
YRYYGTTKVC WLSTENNFIW SFIGPACLII LVNLLAFGVI IYKVFRHTAG
660 670 680 690 700
LKPEVSCYEN IRSCARGALA LLFLLGTTWT FGVLHVVHAS VVTAYLFTVS
710 720 730
NAFQGMFIFL FLCVLSRKIQ EEYYRLFKNV PCCFECLR
Length:738
Mass (Da):82,451
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i680D3731FE60EF95
GO
Isoform 2 (identifier: Q9ESC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-662: VNLLAFGVIIYKVFRHTAGLKPEVSCYENIR → IYILVSFTSHIPLNMCAECRRMVSASLHVRL
     663-738: Missing.

Show »
Length:662
Mass (Da):73,803
Checksum:i0FED646DD20F6F30
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_009415632 – 662VNLLA…YENIR → IYILVSFTSHIPLNMCAECR RMVSASLHVRL in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_009416663 – 738Missing in isoform 2. 1 PublicationAdd BLAST76

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF192401 mRNA Translation: AAG33019.1
AF192402 mRNA Translation: AAG33020.1

NCBI Reference Sequences

More...
RefSeqi
NP_071630.1, NM_022294.1 [Q9ESC1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000047564; ENSRNOP00000045890; ENSRNOG00000033940 [Q9ESC1-2]
ENSRNOT00000088437; ENSRNOP00000071560; ENSRNOG00000033940 [Q9ESC1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64124

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:64124

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF192401 mRNA Translation: AAG33019.1
AF192402 mRNA Translation: AAG33020.1
RefSeqiNP_071630.1, NM_022294.1 [Q9ESC1-1]

3D structure databases

SMRiQ9ESC1
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045890

Protein family/group databases

MEROPSiP02.013

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

GlyGeniQ9ESC1, 8 sites
PhosphoSitePlusiQ9ESC1

Proteomic databases

PaxDbiQ9ESC1

Genome annotation databases

EnsembliENSRNOT00000047564; ENSRNOP00000045890; ENSRNOG00000033940 [Q9ESC1-2]
ENSRNOT00000088437; ENSRNOP00000071560; ENSRNOG00000033940 [Q9ESC1-1]
GeneIDi64124
KEGGirno:64124

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64123
RGDi621136, Adgrl4

Phylogenomic databases

eggNOGiKOG4193, Eukaryota
GeneTreeiENSGT00940000158252
InParanoidiQ9ESC1
OMAiSQCAFWN
OrthoDBi388923at2759
PhylomeDBiQ9ESC1
TreeFamiTF316380

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9ESC1

Gene expression databases

BgeeiENSRNOG00000033940, Expressed in brain and 21 other tissues
GenevisibleiQ9ESC1, RN

Family and domain databases

InterProiView protein in InterPro
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR032471, GAIN_dom_N
IPR017981, GPCR_2-like
IPR000832, GPCR_2_secretin-like
IPR017983, GPCR_2_secretin-like_CS
IPR000203, GPS
PfamiView protein in Pfam
PF00002, 7tm_2, 1 hit
PF07645, EGF_CA, 2 hits
PF16489, GAIN, 1 hit
PF01825, GPS, 1 hit
PRINTSiPR00249, GPCRSECRETIN
SMARTiView protein in SMART
SM00181, EGF, 3 hits
SM00179, EGF_CA, 2 hits
SM00303, GPS, 1 hit
PROSITEiView protein in PROSITE
PS00010, ASX_HYDROXYL, 2 hits
PS01186, EGF_2, 1 hit
PS50026, EGF_3, 3 hits
PS01187, EGF_CA, 2 hits
PS00650, G_PROTEIN_RECEP_F2_2, 1 hit
PS50261, G_PROTEIN_RECEP_F2_4, 1 hit
PS50221, GPS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGRL4_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ESC1
Secondary accession number(s): Q9ESC0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: March 1, 2001
Last modified: December 2, 2020
This is version 148 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again