Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (16 Oct 2019)
Sequence version 2 (06 Feb 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rho guanine nucleotide exchange factor 7

Gene

Arhgef7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. May function as a positive regulator of apoptosis. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor
Biological processNeurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-182971 EGFR downregulation
R-MMU-193648 NRAGE signals death through JNK
R-MMU-194840 Rho GTPase cycle
R-MMU-3928664 Ephrin signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 7
Alternative name(s):
Beta-Pix
PAK-interacting exchange factor beta
p85SPR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Arhgef7
Synonyms:Kiaa0142, Pak3bp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1860493 Arhgef7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809221 – 862Rho guanine nucleotide exchange factor 7Add BLAST862

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei132PhosphoserineCombined sources1
Modified residuei155PhosphoserineCombined sources1
Modified residuei164PhosphoserineCombined sources1
Modified residuei228PhosphoserineBy similarity1
Modified residuei236PhosphoserineBy similarity1
Modified residuei497PhosphoserineCombined sources1
Modified residuei673PhosphoserineCombined sources1
Modified residuei776PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Ser-673 by CaMK1; enhancement of GEF activity and downstream activation of RAC1 (By similarity). Phosphorylated by PTK2/FAK1; this promotes interaction with RAC1.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9ES28

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ES28

PeptideAtlas

More...
PeptideAtlasi
Q9ES28

PRoteomics IDEntifications database

More...
PRIDEi
Q9ES28

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9ES28

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ES28

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9ES28

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Seems to be expressed in the central nervous system. Isoform B, isoform C and isoform E are expressed with highest levels in brain and testis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031511 Expressed in 295 organ(s), highest expression level in cerebral cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9ES28 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9ES28 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PAK kinases through the SH3 domain.

Interacts with unphosphorylated PAK1.

Interacts with ITCH.

Interacts with SCRIB; interaction is direct and may play a role in regulation of apoptosis (By similarity).

Interacts with GIT1 and TGFB1I1.

Interacts with FRMPD4 (via N-terminus).

Interacts with CaMK1.

Interacts with BIN2 (By similarity).

Interacts with PTK2/FAK1 and RAC1.

Interacts with PARVB.

Interacts with YWHAZ (PubMed:16959763).

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
207566, 19 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9ES28

Protein interaction database and analysis system

More...
IntActi
Q9ES28, 22 interactors

Molecular INTeraction database

More...
MINTi
Q9ES28

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106534

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1862
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ES28

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9ES28

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 112Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST112
Domaini163 – 222SH3PROSITE-ProRule annotationAdd BLAST60
Domaini250 – 430DHPROSITE-ProRule annotationAdd BLAST181
Domaini452 – 557PHPROSITE-ProRule annotationAdd BLAST106

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili804 – 854Sequence analysisAdd BLAST51

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2070 Eukaryota
ENOG410XNNP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155360

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ES28

KEGG Orthology (KO)

More...
KOi
K13710

Database of Orthologous Groups

More...
OrthoDBi
547556at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ES28

TreeFam database of animal gene trees

More...
TreeFami
TF316105

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014 CH, 1 hit
cd00160 RhoGEF, 1 hit
cd12061 SH3_betaPIX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035789 BetaPIX_SH3
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR032409 GEF_CC
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16523 betaPIX_CC, 1 hit
PF00307 CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: Q9ES28-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSAEQTVTW LITLGVLESP KKTISDPEVF LQASLKDGVV LCRLLERLLP
60 70 80 90 100
GTIEKVYPEP RNESECLSNI REFLRACGAS LRLETFDAND LYQGQNFNKV
110 120 130 140 150
LSSLVTLNKV TADIGLGSDS VCARPSSHRI KSFDSLGSQS SHSRTSKLLQ
160 170 180 190 200
SQYRSLDMTD NTNSQLVVRA KFNFQQTNED ELSFSKGDVI HVTRVEEGGW
210 220 230 240 250
WEGTHNGRTG WFPSNYVREI KPSEKPVSPK SGTLKSPPKG FDTTAINKSY
260 270 280 290 300
YNVVLQNILE TEHEYSKELQ SVLSTYLRPL QTSDKLSSAN TSYLMGNLEE
310 320 330 340 350
ISSFQQVLVQ SLEECTKSPE AQQRVGGCFL SLMPQMRTLY LAYCANHPSA
360 370 380 390 400
VSVLTEHSED LGEFMETKGA SSPGILVLTT GLSKPFMRLD KYPTLLKELE
410 420 430 440 450
RHMEDYHPDR QDIQKSMTAF KNLSAQCQEV RKRKELELQI LTEPIRSWEG
460 470 480 490 500
DDIKTLGSVT YMSQVTIQCA GSEEKNERYL LLFPNLLLML SASPRMSGFI
510 520 530 540 550
YQGKLPTTGM TITKLEDSEN HRNAFEISGS MIERILVSCT SQQDLHEWVE
560 570 580 590 600
HLQKQTKVTS VSNPTIKPHS VPSHTLPSHP LTPSSKHADS KPVALTPAYH
610 620 630 640 650
TLPHPSHHGT PHTTISWGPL EPPKTPKPWS LSCLRPAPPL RPSAALCYKE
660 670 680 690 700
DLSKSPKTMK KLLPKRKPER KPSDEEFAVR KSTAALEEDA QILKVIEAYC
710 720 730 740 750
TSAKTRQTLN STWQGTDLMH NHVLADDDQS SLDSLGRRSS LSRLEPSDLS
760 770 780 790 800
EDSEYDSIWT AHSYRMGSAS RSRKESAPQV LLPEEEKIIV EETKSNGQTV
810 820 830 840 850
IEEKSLVDTV YALKDEVQEL RQDNKKMKKS LEEEQRARKD LEKLVRKVLK
860
NMNDPAWDET NL
Length:862
Mass (Da):97,056
Last modified:February 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i46D61B606B8391B4
GO
Isoform A (identifier: Q9ES28-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S

Show »
Length:803
Mass (Da):90,390
Checksum:iC829852E0C7EA8CD
GO
Isoform C (identifier: Q9ES28-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     576-650: Missing.

Show »
Length:787
Mass (Da):88,950
Checksum:iEEB889F6BE45B63D
GO
Isoform D (identifier: Q9ES28-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ
     712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S

Show »
Length:751
Mass (Da):84,698
Checksum:i43F22A9DF918F599
GO
Isoform E (identifier: Q9ES28-5) [UniParc]FASTAAdd to basket
Also known as: d

The sequence of this isoform differs from the canonical sequence as follows:
     772-824: SRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDN → KSCCSYISHQN
     825-862: Missing.

Show »
Length:782
Mass (Da):87,673
Checksum:i9B38100E66FFDAD9
GO
Isoform F (identifier: Q9ES28-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ
     712-820: TWQGTDLMHN...YALKDEVQEL → SECRSSPRVGTDYKQLLHGLAALEREVSGA
     821-862: Missing.

Show »
Length:689
Mass (Da):77,189
Checksum:i78B03ECBB4E8A3F4
GO
Isoform G (identifier: Q9ES28-7) [UniParc]FASTAAdd to basket
Also known as: b(L)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ

Show »
Length:810
Mass (Da):91,364
Checksum:i61F15448C29152B0
GO
Isoform H (identifier: Q9ES28-8) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     1-157: Missing.

Note: Produced by alternative initiation at Met-158 of isoform G.
Show »
Length:705
Mass (Da):79,696
Checksum:i60F3F1CA3589637C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z0V2D3Z0V2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
636Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0X8A0A0R4J0X8_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7 mCG_11179
646Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GRS3A0A1B0GRS3_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GSX2A0A1B0GSX2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GSX4A0A1B0GSX4_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB57691 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAG18017 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAG18018 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH44838 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAK97363 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC35033 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC97874 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti485 – 488NLLL → KPSV in AAO65479 (PubMed:15120616).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAG18017 (PubMed:10860822).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAG18018 (PubMed:10860822).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAB57691 (PubMed:9207241).Curated4
Sequence conflicti492A → P in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti492A → P in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti492A → P in AAG18018 (PubMed:10860822).Curated1
Sequence conflicti492A → P in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti616S → R in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti616S → R in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti616S → R in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti624 – 625KT → PH in AAB57691 (PubMed:9207241).Curated2
Sequence conflicti628P → A in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti628P → A in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti630S → G in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti633C → W in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti633C → W in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti633C → W in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti635 – 636RP → WT in AAB57691 (PubMed:9207241).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0230511 – 157Missing in isoform H. 2 PublicationsAdd BLAST157
Alternative sequenceiVSP_0230521 – 52Missing in isoform D, isoform F and isoform G. 3 PublicationsAdd BLAST52
Alternative sequenceiVSP_02305353 – 55IEK → MLQ in isoform D, isoform F and isoform G. 3 Publications3
Alternative sequenceiVSP_001816576 – 650Missing in isoform C. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_023054712 – 820TWQGT…EVQEL → SECRSSPRVGTDYKQLLHGL AALEREVSGA in isoform F. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_001817712 – 771TWQGT…GSASR → S in isoform A and isoform D. 3 PublicationsAdd BLAST60
Alternative sequenceiVSP_023055772 – 824SRKES…LRQDN → KSCCSYISHQN in isoform E. 4 PublicationsAdd BLAST53
Alternative sequenceiVSP_023056821 – 862Missing in isoform F. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_023057825 – 862Missing in isoform E. 4 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129064 mRNA Translation: BAC97874.1 Different initiation.
AY220301 mRNA Translation: AAO65479.1
AK052545 mRNA Translation: BAC35033.1 Different initiation.
AK139156 mRNA Translation: BAE23905.1
BC044838 mRNA Translation: AAH44838.1 Different initiation.
AF247654 mRNA Translation: AAG18017.1 Different initiation.
AF247655 mRNA Translation: AAG18018.1 Different initiation.
AF343877 mRNA Translation: AAK97363.1 Different initiation.
U96634 mRNA Translation: AAB57691.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS52480.1 [Q9ES28-5]
CCDS52481.1 [Q9ES28-8]

NCBI Reference Sequences

More...
RefSeqi
NP_001106989.1, NM_001113517.1 [Q9ES28-5]
NP_001106990.1, NM_001113518.1 [Q9ES28-8]
NP_059098.2, NM_017402.4
XP_006508904.2, XM_006508841.2 [Q9ES28-1]
XP_006508906.2, XM_006508843.3 [Q9ES28-2]
XP_006508907.2, XM_006508844.2 [Q9ES28-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000098938; ENSMUSP00000096538; ENSMUSG00000031511 [Q9ES28-8]
ENSMUST00000110909; ENSMUSP00000106534; ENSMUSG00000031511 [Q9ES28-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54126

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:54126

UCSC genome browser

More...
UCSCi
uc009kvu.2 mouse [Q9ES28-2]
uc009kvv.2 mouse [Q9ES28-5]
uc009kvw.2 mouse [Q9ES28-4]
uc009kvx.2 mouse [Q9ES28-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129064 mRNA Translation: BAC97874.1 Different initiation.
AY220301 mRNA Translation: AAO65479.1
AK052545 mRNA Translation: BAC35033.1 Different initiation.
AK139156 mRNA Translation: BAE23905.1
BC044838 mRNA Translation: AAH44838.1 Different initiation.
AF247654 mRNA Translation: AAG18017.1 Different initiation.
AF247655 mRNA Translation: AAG18018.1 Different initiation.
AF343877 mRNA Translation: AAK97363.1 Different initiation.
U96634 mRNA Translation: AAB57691.1 Different initiation.
CCDSiCCDS52480.1 [Q9ES28-5]
CCDS52481.1 [Q9ES28-8]
RefSeqiNP_001106989.1, NM_001113517.1 [Q9ES28-5]
NP_001106990.1, NM_001113518.1 [Q9ES28-8]
NP_059098.2, NM_017402.4
XP_006508904.2, XM_006508841.2 [Q9ES28-1]
XP_006508906.2, XM_006508843.3 [Q9ES28-2]
XP_006508907.2, XM_006508844.2 [Q9ES28-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ESWX-ray2.01A/B164-220[»]
SMRiQ9ES28
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi207566, 19 interactors
CORUMiQ9ES28
IntActiQ9ES28, 22 interactors
MINTiQ9ES28
STRINGi10090.ENSMUSP00000106534

PTM databases

iPTMnetiQ9ES28
PhosphoSitePlusiQ9ES28
SwissPalmiQ9ES28

Proteomic databases

jPOSTiQ9ES28
PaxDbiQ9ES28
PeptideAtlasiQ9ES28
PRIDEiQ9ES28

Genome annotation databases

EnsembliENSMUST00000098938; ENSMUSP00000096538; ENSMUSG00000031511 [Q9ES28-8]
ENSMUST00000110909; ENSMUSP00000106534; ENSMUSG00000031511 [Q9ES28-5]
GeneIDi54126
KEGGimmu:54126
UCSCiuc009kvu.2 mouse [Q9ES28-2]
uc009kvv.2 mouse [Q9ES28-5]
uc009kvw.2 mouse [Q9ES28-4]
uc009kvx.2 mouse [Q9ES28-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8874
MGIiMGI:1860493 Arhgef7

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG2070 Eukaryota
ENOG410XNNP LUCA
GeneTreeiENSGT00940000155360
InParanoidiQ9ES28
KOiK13710
OrthoDBi547556at2759
PhylomeDBiQ9ES28
TreeFamiTF316105

Enzyme and pathway databases

ReactomeiR-MMU-182971 EGFR downregulation
R-MMU-193648 NRAGE signals death through JNK
R-MMU-194840 Rho GTPase cycle
R-MMU-3928664 Ephrin signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Arhgef7 mouse
EvolutionaryTraceiQ9ES28

Protein Ontology

More...
PROi
PR:Q9ES28

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031511 Expressed in 295 organ(s), highest expression level in cerebral cortex
ExpressionAtlasiQ9ES28 baseline and differential
GenevisibleiQ9ES28 MM

Family and domain databases

CDDicd00014 CH, 1 hit
cd00160 RhoGEF, 1 hit
cd12061 SH3_betaPIX, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035789 BetaPIX_SH3
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR032409 GEF_CC
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF16523 betaPIX_CC, 1 hit
PF00307 CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHG7_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ES28
Secondary accession number(s): O08757
, Q3UTS5, Q6XPA5, Q6ZQI5, Q8C750, Q91ZZ6, Q9ES27
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: February 6, 2007
Last modified: October 16, 2019
This is version 178 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again