Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 7

Gene

Arhgef7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. May function as a positive regulator of apoptosis. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons (By similarity).By similarity1 Publication

GO - Molecular functioni

  • guanyl-nucleotide exchange factor activity Source: MGI
  • protein kinase binding Source: BHF-UCL
  • Rho guanyl-nucleotide exchange factor activity Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor
Biological processNeurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-182971 EGFR downregulation
R-MMU-193648 NRAGE signals death through JNK
R-MMU-194840 Rho GTPase cycle
R-MMU-3928664 Ephrin signaling
R-MMU-416482 G alpha (12/13) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 7
Alternative name(s):
Beta-Pix
PAK-interacting exchange factor beta
p85SPR
Gene namesi
Name:Arhgef7
Synonyms:Kiaa0142, Pak3bp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1860493 Arhgef7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809221 – 862Rho guanine nucleotide exchange factor 7Add BLAST862

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei132PhosphoserineCombined sources1
Modified residuei155PhosphoserineCombined sources1
Modified residuei164PhosphoserineCombined sources1
Modified residuei228PhosphoserineBy similarity1
Modified residuei236PhosphoserineBy similarity1
Modified residuei497PhosphoserineCombined sources1
Modified residuei673PhosphoserineCombined sources1
Modified residuei776PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on Ser-673 by CaMK1; enhancement of GEF activity and downstream activation of RAC1 (By similarity). Phosphorylated by PTK2/FAK1; this promotes interaction with RAC1.By similarity1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9ES28
PeptideAtlasiQ9ES28
PRIDEiQ9ES28

PTM databases

iPTMnetiQ9ES28
PhosphoSitePlusiQ9ES28

Expressioni

Tissue specificityi

Seems to be expressed in the central nervous system. Isoform B, isoform C and isoform E are expressed with highest levels in brain and testis.2 Publications

Gene expression databases

BgeeiENSMUSG00000031511 Expressed in 295 organ(s), highest expression level in cerebral cortex
CleanExiMM_ARHGEF7
ExpressionAtlasiQ9ES28 baseline and differential
GenevisibleiQ9ES28 MM

Interactioni

Subunit structurei

Interacts with PAK kinases through the SH3 domain. Interacts with unphosphorylated PAK1. Interacts with ITCH. Interacts with SCRIB; interaction is direct and may play a role in regulation of apoptosis (By similarity). Interacts with GIT1 and TGFB1I1. Interacts with FRMPD4 (via N-terminus). Interacts with CaMK1. Interacts with BIN2 (By similarity). Interacts with PTK2/FAK1 and RAC1. Interacts with PARVB.By similarity4 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi207566, 17 interactors
CORUMiQ9ES28
IntActiQ9ES28, 22 interactors
MINTiQ9ES28
STRINGi10090.ENSMUSP00000106534

Structurei

Secondary structure

1862
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9ES28
SMRiQ9ES28
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9ES28

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 112Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST112
Domaini163 – 222SH3PROSITE-ProRule annotationAdd BLAST60
Domaini250 – 430DHPROSITE-ProRule annotationAdd BLAST181
Domaini452 – 557PHPROSITE-ProRule annotationAdd BLAST106

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili804 – 854Sequence analysisAdd BLAST51

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiKOG2070 Eukaryota
ENOG410XNNP LUCA
GeneTreeiENSGT00930000150955
HOVERGENiHBG050569
InParanoidiQ9ES28
KOiK13710
OrthoDBiEOG091G04XA
PhylomeDBiQ9ES28
TreeFamiTF316105

Family and domain databases

CDDicd00014 CH, 1 hit
cd00160 RhoGEF, 1 hit
cd12061 SH3_betaPIX, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035789 BetaPIX_SH3
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR032409 GEF_CC
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF16523 betaPIX_CC, 1 hit
PF00307 CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: Q9ES28-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSAEQTVTW LITLGVLESP KKTISDPEVF LQASLKDGVV LCRLLERLLP
60 70 80 90 100
GTIEKVYPEP RNESECLSNI REFLRACGAS LRLETFDAND LYQGQNFNKV
110 120 130 140 150
LSSLVTLNKV TADIGLGSDS VCARPSSHRI KSFDSLGSQS SHSRTSKLLQ
160 170 180 190 200
SQYRSLDMTD NTNSQLVVRA KFNFQQTNED ELSFSKGDVI HVTRVEEGGW
210 220 230 240 250
WEGTHNGRTG WFPSNYVREI KPSEKPVSPK SGTLKSPPKG FDTTAINKSY
260 270 280 290 300
YNVVLQNILE TEHEYSKELQ SVLSTYLRPL QTSDKLSSAN TSYLMGNLEE
310 320 330 340 350
ISSFQQVLVQ SLEECTKSPE AQQRVGGCFL SLMPQMRTLY LAYCANHPSA
360 370 380 390 400
VSVLTEHSED LGEFMETKGA SSPGILVLTT GLSKPFMRLD KYPTLLKELE
410 420 430 440 450
RHMEDYHPDR QDIQKSMTAF KNLSAQCQEV RKRKELELQI LTEPIRSWEG
460 470 480 490 500
DDIKTLGSVT YMSQVTIQCA GSEEKNERYL LLFPNLLLML SASPRMSGFI
510 520 530 540 550
YQGKLPTTGM TITKLEDSEN HRNAFEISGS MIERILVSCT SQQDLHEWVE
560 570 580 590 600
HLQKQTKVTS VSNPTIKPHS VPSHTLPSHP LTPSSKHADS KPVALTPAYH
610 620 630 640 650
TLPHPSHHGT PHTTISWGPL EPPKTPKPWS LSCLRPAPPL RPSAALCYKE
660 670 680 690 700
DLSKSPKTMK KLLPKRKPER KPSDEEFAVR KSTAALEEDA QILKVIEAYC
710 720 730 740 750
TSAKTRQTLN STWQGTDLMH NHVLADDDQS SLDSLGRRSS LSRLEPSDLS
760 770 780 790 800
EDSEYDSIWT AHSYRMGSAS RSRKESAPQV LLPEEEKIIV EETKSNGQTV
810 820 830 840 850
IEEKSLVDTV YALKDEVQEL RQDNKKMKKS LEEEQRARKD LEKLVRKVLK
860
NMNDPAWDET NL
Length:862
Mass (Da):97,056
Last modified:February 6, 2007 - v2
Checksum:i46D61B606B8391B4
GO
Isoform A (identifier: Q9ES28-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S

Show »
Length:803
Mass (Da):90,390
Checksum:iC829852E0C7EA8CD
GO
Isoform C (identifier: Q9ES28-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     576-650: Missing.

Show »
Length:787
Mass (Da):88,950
Checksum:iEEB889F6BE45B63D
GO
Isoform D (identifier: Q9ES28-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ
     712-771: TWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASR → S

Show »
Length:751
Mass (Da):84,698
Checksum:i43F22A9DF918F599
GO
Isoform E (identifier: Q9ES28-5) [UniParc]FASTAAdd to basket
Also known as: d

The sequence of this isoform differs from the canonical sequence as follows:
     772-824: SRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDN → KSCCSYISHQN
     825-862: Missing.

Show »
Length:782
Mass (Da):87,673
Checksum:i9B38100E66FFDAD9
GO
Isoform F (identifier: Q9ES28-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ
     712-820: TWQGTDLMHN...YALKDEVQEL → SECRSSPRVGTDYKQLLHGLAALEREVSGA
     821-862: Missing.

Show »
Length:689
Mass (Da):77,189
Checksum:i78B03ECBB4E8A3F4
GO
Isoform G (identifier: Q9ES28-7) [UniParc]FASTAAdd to basket
Also known as: b(L)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     53-55: IEK → MLQ

Show »
Length:810
Mass (Da):91,364
Checksum:i61F15448C29152B0
GO
Isoform H (identifier: Q9ES28-8) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     1-157: Missing.

Note: Produced by alternative initiation at Met-158 of isoform G.
Show »
Length:705
Mass (Da):79,696
Checksum:i60F3F1CA3589637C
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z0V2D3Z0V2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
636Annotation score:
A0A0R4J0X8A0A0R4J0X8_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7 mCG_11179
646Annotation score:
A0A1B0GRS3A0A1B0GRS3_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
200Annotation score:
A0A1B0GSX2A0A1B0GSX2_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
131Annotation score:
A0A1B0GSX4A0A1B0GSX4_MOUSE
Rho guanine nucleotide exchange fac...
Arhgef7
68Annotation score:

Sequence cautioni

The sequence AAB57691 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAG18017 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAG18018 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH44838 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAK97363 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC35033 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC97874 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAE23905 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti485 – 488NLLL → KPSV in AAO65479 (PubMed:15120616).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAG18017 (PubMed:10860822).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAG18018 (PubMed:10860822).Curated4
Sequence conflicti485 – 488NLLL → KPSV in AAB57691 (PubMed:9207241).Curated4
Sequence conflicti492A → P in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti492A → P in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti492A → P in AAG18018 (PubMed:10860822).Curated1
Sequence conflicti492A → P in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti616S → R in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti616S → R in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti616S → R in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti624 – 625KT → PH in AAB57691 (PubMed:9207241).Curated2
Sequence conflicti628P → A in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti628P → A in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti630S → G in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti633C → W in AAO65479 (PubMed:15120616).Curated1
Sequence conflicti633C → W in AAG18017 (PubMed:10860822).Curated1
Sequence conflicti633C → W in AAB57691 (PubMed:9207241).Curated1
Sequence conflicti635 – 636RP → WT in AAB57691 (PubMed:9207241).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0230511 – 157Missing in isoform H. 2 PublicationsAdd BLAST157
Alternative sequenceiVSP_0230521 – 52Missing in isoform D, isoform F and isoform G. 3 PublicationsAdd BLAST52
Alternative sequenceiVSP_02305353 – 55IEK → MLQ in isoform D, isoform F and isoform G. 3 Publications3
Alternative sequenceiVSP_001816576 – 650Missing in isoform C. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_023054712 – 820TWQGT…EVQEL → SECRSSPRVGTDYKQLLHGL AALEREVSGA in isoform F. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_001817712 – 771TWQGT…GSASR → S in isoform A and isoform D. 3 PublicationsAdd BLAST60
Alternative sequenceiVSP_023055772 – 824SRKES…LRQDN → KSCCSYISHQN in isoform E. 4 PublicationsAdd BLAST53
Alternative sequenceiVSP_023056821 – 862Missing in isoform F. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_023057825 – 862Missing in isoform E. 4 PublicationsAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129064 mRNA Translation: BAC97874.1 Different initiation.
AY220301 mRNA Translation: AAO65479.1
AK052545 mRNA Translation: BAC35033.1 Different initiation.
AK139156 mRNA Translation: BAE23905.1 Different initiation.
BC044838 mRNA Translation: AAH44838.1 Different initiation.
AF247654 mRNA Translation: AAG18017.1 Different initiation.
AF247655 mRNA Translation: AAG18018.1 Different initiation.
AF343877 mRNA Translation: AAK97363.1 Different initiation.
U96634 mRNA Translation: AAB57691.1 Different initiation.
CCDSiCCDS52480.1 [Q9ES28-5]
CCDS52481.1 [Q9ES28-8]
RefSeqiNP_001106989.1, NM_001113517.1 [Q9ES28-5]
NP_001106990.1, NM_001113518.1 [Q9ES28-8]
NP_059098.2, NM_017402.4
XP_006508904.2, XM_006508841.2 [Q9ES28-1]
XP_006508906.2, XM_006508843.3 [Q9ES28-2]
XP_006508907.2, XM_006508844.2 [Q9ES28-3]
UniGeneiMm.244068

Genome annotation databases

EnsembliENSMUST00000098938; ENSMUSP00000096538; ENSMUSG00000031511 [Q9ES28-8]
ENSMUST00000110909; ENSMUSP00000106534; ENSMUSG00000031511 [Q9ES28-5]
GeneIDi54126
KEGGimmu:54126
UCSCiuc009kvu.2 mouse [Q9ES28-2]
uc009kvv.2 mouse [Q9ES28-5]
uc009kvw.2 mouse [Q9ES28-4]
uc009kvx.2 mouse [Q9ES28-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129064 mRNA Translation: BAC97874.1 Different initiation.
AY220301 mRNA Translation: AAO65479.1
AK052545 mRNA Translation: BAC35033.1 Different initiation.
AK139156 mRNA Translation: BAE23905.1 Different initiation.
BC044838 mRNA Translation: AAH44838.1 Different initiation.
AF247654 mRNA Translation: AAG18017.1 Different initiation.
AF247655 mRNA Translation: AAG18018.1 Different initiation.
AF343877 mRNA Translation: AAK97363.1 Different initiation.
U96634 mRNA Translation: AAB57691.1 Different initiation.
CCDSiCCDS52480.1 [Q9ES28-5]
CCDS52481.1 [Q9ES28-8]
RefSeqiNP_001106989.1, NM_001113517.1 [Q9ES28-5]
NP_001106990.1, NM_001113518.1 [Q9ES28-8]
NP_059098.2, NM_017402.4
XP_006508904.2, XM_006508841.2 [Q9ES28-1]
XP_006508906.2, XM_006508843.3 [Q9ES28-2]
XP_006508907.2, XM_006508844.2 [Q9ES28-3]
UniGeneiMm.244068

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ESWX-ray2.01A/B164-220[»]
ProteinModelPortaliQ9ES28
SMRiQ9ES28
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207566, 17 interactors
CORUMiQ9ES28
IntActiQ9ES28, 22 interactors
MINTiQ9ES28
STRINGi10090.ENSMUSP00000106534

PTM databases

iPTMnetiQ9ES28
PhosphoSitePlusiQ9ES28

Proteomic databases

PaxDbiQ9ES28
PeptideAtlasiQ9ES28
PRIDEiQ9ES28

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000098938; ENSMUSP00000096538; ENSMUSG00000031511 [Q9ES28-8]
ENSMUST00000110909; ENSMUSP00000106534; ENSMUSG00000031511 [Q9ES28-5]
GeneIDi54126
KEGGimmu:54126
UCSCiuc009kvu.2 mouse [Q9ES28-2]
uc009kvv.2 mouse [Q9ES28-5]
uc009kvw.2 mouse [Q9ES28-4]
uc009kvx.2 mouse [Q9ES28-1]

Organism-specific databases

CTDi8874
MGIiMGI:1860493 Arhgef7
RougeiSearch...

Phylogenomic databases

eggNOGiKOG2070 Eukaryota
ENOG410XNNP LUCA
GeneTreeiENSGT00930000150955
HOVERGENiHBG050569
InParanoidiQ9ES28
KOiK13710
OrthoDBiEOG091G04XA
PhylomeDBiQ9ES28
TreeFamiTF316105

Enzyme and pathway databases

ReactomeiR-MMU-182971 EGFR downregulation
R-MMU-193648 NRAGE signals death through JNK
R-MMU-194840 Rho GTPase cycle
R-MMU-3928664 Ephrin signaling
R-MMU-416482 G alpha (12/13) signalling events

Miscellaneous databases

ChiTaRSiArhgef7 mouse
EvolutionaryTraceiQ9ES28
PROiPR:Q9ES28
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031511 Expressed in 295 organ(s), highest expression level in cerebral cortex
CleanExiMM_ARHGEF7
ExpressionAtlasiQ9ES28 baseline and differential
GenevisibleiQ9ES28 MM

Family and domain databases

CDDicd00014 CH, 1 hit
cd00160 RhoGEF, 1 hit
cd12061 SH3_betaPIX, 1 hit
Gene3Di1.10.418.10, 1 hit
1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035789 BetaPIX_SH3
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR032409 GEF_CC
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF16523 betaPIX_CC, 1 hit
PF00307 CH, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
SSF48065 SSF48065, 1 hit
SSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiARHG7_MOUSE
AccessioniPrimary (citable) accession number: Q9ES28
Secondary accession number(s): O08757
, Q3UTS5, Q6XPA5, Q6ZQI5, Q8C750, Q91ZZ6, Q9ES27
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: February 6, 2007
Last modified: November 7, 2018
This is version 171 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again