Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (05 Jun 2019)
Sequence version 2 (26 Sep 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Versican core protein

Gene

Vcan

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium, Hyaluronic acid, Lectin

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-1971475 A tetrasaccharide linker sequence is required for GAG synthesis
R-RNO-2022870 Chondroitin sulfate biosynthesis
R-RNO-2022923 Dermatan sulfate biosynthesis
R-RNO-2024101 CS/DS degradation
R-RNO-3000178 ECM proteoglycans
R-RNO-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-RNO-8957275 Post-translational protein phosphorylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Versican core protein
Alternative name(s):
Chondroitin sulfate proteoglycan core protein 2
Short name:
Chondroitin sulfate proteoglycan 2
Glial hyaluronate-binding protein
Short name:
GHAP
Large fibroblast proteoglycan
PG-M
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Vcan
Synonyms:Cspg2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
619940 Vcan

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Sequence analysisAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001752421 – 2738Versican core proteinAdd BLAST2718

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi44 ↔ 130By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi57N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi172 ↔ 243By similarity
Disulfide bondi196 ↔ 217By similarity
Disulfide bondi270 ↔ 345By similarity
Disulfide bondi294 ↔ 315By similarity
Glycosylationi330N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi692N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi758N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi802N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi805N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1257N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1435N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1633N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1660N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1684N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1738N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1848N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1963PhosphoserineBy similarity1
Modified residuei1964PhosphoserineBy similarity1
Glycosylationi2004N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2409N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi2435 ↔ 2446By similarity
Disulfide bondi2440 ↔ 2455By similarity
Disulfide bondi2457 ↔ 2466By similarity
Disulfide bondi2473 ↔ 2484By similarity
Disulfide bondi2478 ↔ 2493By similarity
Disulfide bondi2495 ↔ 2504By similarity
Disulfide bondi2511 ↔ 2522By similarity
Disulfide bondi2539 ↔ 2631By similarity
Disulfide bondi2607 ↔ 2623By similarity
Disulfide bondi2638 ↔ 2681By similarity
Disulfide bondi2667 ↔ 2694By similarity
Glycosylationi2711N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2721N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by FAM20C in the extracellular medium.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Proteoglycan

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9ERB4

PRoteomics IDEntifications database

More...
PRIDEi
Q9ERB4

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9ERB4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In kidney is expressed in the papillary area, but not in glomeruli.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Disappears after the cartilage development.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FBLN1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
250300, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000045935

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9ERB4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 146Ig-like V-typeAdd BLAST126
Domaini150 – 245Link 1PROSITE-ProRule annotationAdd BLAST96
Domaini251 – 347Link 2PROSITE-ProRule annotationAdd BLAST97
Domaini2431 – 2467EGF-like 1PROSITE-ProRule annotationAdd BLAST37
Domaini2469 – 2505EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST37
Domaini2518 – 2632C-type lectinPROSITE-ProRule annotationAdd BLAST115
Domaini2636 – 2696SushiPROSITE-ProRule annotationAdd BLAST61

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni‹349 – 695GAG-alpha (glucosaminoglycan attachment domain)Add BLAST›347
Regioni696 – 2431GAG-betaAdd BLAST1736

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Repeat, Signal, Sushi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFXS Eukaryota
ENOG410ZPDG LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168523

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9ERB4

KEGG Orthology (KO)

More...
KOi
K06793

Database of Orthologous Groups

More...
OrthoDBi
74642at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9ERB4

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033 CCP, 1 hit
cd03588 CLECT_CSPGs, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit
3.10.100.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR033987 CSPG_CTLD
IPR016187 CTDL_fold
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR000538 Link_dom
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008 EGF, 2 hits
PF00059 Lectin_C, 1 hit
PF00084 Sushi, 1 hit
PF07686 V-set, 1 hit
PF00193 Xlink, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01265 LINKMODULE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032 CCP, 1 hit
SM00034 CLECT, 1 hit
SM00181 EGF, 2 hits
SM00179 EGF_CA, 2 hits
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SM00445 LINK, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit
SSF56436 SSF56436, 3 hits
SSF57535 SSF57535, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 2 hits
PS01187 EGF_CA, 1 hit
PS50835 IG_LIKE, 1 hit
PS01241 LINK_1, 2 hits
PS50963 LINK_2, 2 hits
PS50923 SUSHI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Fragments.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform V0 (identifier: Q9ERB4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLINMNGILW MCSTLLLTHA LHKAKMEENP PVKGSLSGKV ILPCHFSTLP
60 70 80 90 100
TLPPDYNTSE FLRIKWSKIE VDKNGKDIKE TTVLVAQDGN IKIGQDYKGR
110 120 130 140 150
VSVPTHPDDV GDASLTMVKL RASDAGVYRC DVMYGIEDTQ NTMSLAVDGV
160 170 180 190 200
VFHYRAATSR YTLNFESAQQ ACLDIGAVIA TPEQLFAAYE DGFEQCDAGW
210 220 230 240 250
LSDQTVRYPI RAPREGCYGD MMGKEGVRTY GFRSPQETYD VYCYVDHLDG
260 270 280 290 300
DVFHITAPSK FTFEEAEAEC ANRDARLATV GELHAAWRNG FDQCDYGWLS
310 320 330 340 350
DASVRHPVTV ARAQCGGGLL GVRTLYRFEN QTCFPLPDSR FDAYCFKRSP
360 370 380 390 400
LSIIPKTEWS VSETSVPLED EVLGKSDQDT LEQTHLEATM SPEALSTIEV
410 420 430 440 450
TQGETQEEPQ TPGIPFPALS STAVMTKETT AFEEEGEGST YTLSEDRLMT
460 470 480 490 500
DSEIVPSLET TPVGTSYPGG AMTQQEVEMD TMVTQMSSIR PTVVLSTEPE
510 520 530 540 550
VSYEAEGSSP MEFASTLKPF GTQVTQLVEE TTEEGKKTPL DYTDLGSGLF
560 570 580 590 600
EQPRVTELPD FSMTPSDISV FTAIDSLHRT TPLRPPSPFT EEPHIFEKEP
610 620 630 640 650
SEKTTGDIIL PRESVTQHPL TTLMDIIAKK TESDIDHEYH MTSKPPVMQP
660 670 680 690 700
TRPSVVERKT TSKPQELSTS PPPAGTKFHP DINVYIIEVR ENKTGRMSDM
710 720 730 740 750
VVNGHPIDSE SKEEEPCSEE TDPLHDLFAE ILPELPDSFE IDIYHSEEDE
760 770 780 790 800
DGEEDCVNAT DVTTTPSVQY ITGKPHVTTV PKNPEAAEAR RGLYESVAPS
810 820 830 840 850
QNFSNTSATD THQFIPAETE LSTTMQFTKS KEATELLEIT WKPETYPETP
860 870 880 890 900
EHFSSGEPDV FPTLPSHDGK TTKWSEFITE SNPNTENPEH KQPKPIPLFP
910 920 930 940 950
EEFSGEGAID QASQQTIFSR ATEVALGKET DQSPTISTSS IRSGSVSVHA
960 970 980 990 1000
LEEDPIALTG ISQTDESMST VESWVEMTPS QTVEFSGSSS APTIEGSGEV
1010 1020 1030 1040 1050
EEYTNKIFNT VTDLPQREPT DTLIPLDMSN IMITDHHIYT PATTAPLDSQ
1060 1070 1080 1090 1100
LPSTDARPTQ FGIQTTTSEW VSSTSFEGRK TEEDKERDTN AAHTGEVQPA
1110 1120 1130 1140 1150
TERSDRLLLT SELESSNVAA SSPLDTWEGF VPETTSTVSE KEMANTTPVF
1160 1170 1180 1190 1200
TETSDVANLE TQSFEHSSSS QPRVQEELTT LSGKPPLIFM DLGSGDASTD
1210 1220 1230 1240 1250
MEFITASSFT LDLESDTKVK KELPSTLSPS VETSSSSEPI GLAPSTVLDI
1260 1270 1280 1290 1300
EIVEVMNQTS KKTLISELSG KPTSQAEVRD LYPGLGEDFS GDSSEYPTVS
1310 1320 1330 1340 1350
STTMKEETVG MGGSENERVK DTQTLSSIPP TSDNINPVPD SKGFGSTVAS
1360 1370 1380 1390 1400
TTAFPWEEFM TSAEGSGEEL SSVRSSVSLV LPLGVDILPT TESPYFDQEF
1410 1420 1430 1440 1450
EEAAAVTEAG KQSALPIAVS GNTVDLTENR DIEVNSTMSV DLPQTMEPAK
1460 1470 1480 1490 1500
LWSKPEVNPE KQEIGSETVT QDKAQGQKSF ESLHSSLAPE QTTLESQSLI
1510 1520 1530 1540 1550
ETEVQTSYYS MLTTMKTYNT NEEVEEEGTS IAHMSTPGPG IKGLESYPTH
1560 1570 1580 1590 1600
PEATGKSYSF SASALVTESG PARSVVMDSS TQEEESIKLF QKDMILTHKE
1610 1620 1630 1640 1650
SNSDLSFSGL GSGEALPPLP TTSVSLTDMG KINSTLYPET SHMESLGTSI
1660 1670 1680 1690 1700
LGDNHERMKN VSNEVRTLIS ETGSISQDST EAPNTTLSDT RTEESTTSPL
1710 1720 1730 1740 1750
PFMKLMDTEH SPKQTLRWEE EIQTHRPQTM TGQMTNDNSS VSEAEAAATS
1760 1770 1780 1790 1800
APAFLPETYS VEMTKAFATS PSQTSDLFDA NSGEGSGEVD GLDLVYTSRT
1810 1820 1830 1840 1850
TQASSQGDSM FASHGFIEKH PEVSRTETGA TDGSPTASAM FLHQSEYNES
1860 1870 1880 1890 1900
SLYPTSTLPS TVTYESPSEG IADGLQDHIR FEVSTLKPSR RKATESVIID
1910 1920 1930 1940 1950
LDKEDSKDLG LAITESAIVE ILPELTSDRN IIIDIDHTKP VYEYIPGIQT
1960 1970 1980 1990 2000
DLDSDIPLGS HGSSEESLEV QEKYEATINL SPTEEAFDGS GDALPAGHTQ
2010 2020 2030 2040 2050
AIYNESVTPS DGKQPEDISF SFATGIPVSS TETELNTFFP TVSTLHIPSK
2060 2070 2080 2090 2100
LTTASPEIDK PNIEAISLDD IFESSTLSDG QAIADQSEVI STLGHLEKTQ
2110 2120 2130 2140 2150
EEYEEKKYGG PSFQPEFFSG VGEVFTDAPA YVSIGRTYSV AQPLTEFPNV
2160 2170 2180 2190 2200
VGQSDSTHYT EATSAVSSVT ELSPQTPSSP SPVYIDSGVS EFTEVPHKSA
2210 2220 2230 2240 2250
QPAPTAASSQ KLIEGSFKKV RANIEATIKS LGENDHGTES PSMSPSPALD
2260 2270 2280 2290 2300
ISEDDSKPKL LEDLETSPTK TETSQDSPNK ANDQIPGKTA GILAGIKTTE
2310 2320 2330 2340 2350
SGPVVTAADD MELGDATQRP HSASAPAAFR VETSMVPQPI PQEPERPTFP
2360 2370 2380 2390 2400
SLEINHETHT SLFEESILAT SEKQVSQRIL DYSNQATVST LDLNTEHSIP
2410 2420 2430 2440 2450
PFSILDNSNE TAFLIGISEE TVEGTAVYLP GPDLCKTNPC LNGGTCYPTE
2460 2470 2480 2490 2500
TSYVCTCAPG YSGDQCELDF DECHSNPCRN GATCVDGLNT FRCLCLPSYV
2510 2520 2530 2540 2550
GALCEQDTET CDYGWHKFQG QCYKYFAHRR TWDAAERECR LQGAHLTSIL
2560 2570 2580 2590 2600
SHEEQMFVNR VGHDYQWIGL NDKMFEHDFR WTDGSALQYE NWRPNQPDSF
2610 2620 2630 2640 2650
FSAGEDCVVI IWHENGQWND VPCNYHLTYT CKKGTVACGQ PPVVENAKTF
2660 2670 2680 2690 2700
GKMKPRYEIN SLIRYHCKDG FIQRHLPTIR CLGNGRWAMP KITCMNPSAY
2710 2720 2730
QRTYSKKYLK NSSSVKDNSI NTSKHEHRWS RRWQETRR
Length:2,738
Mass (Da):300,008
Last modified:September 26, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i12CA626D58BD8C6A
GO
Isoform V3 (identifier: Q9ERB4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-2431: Missing.

Show »
Length:655
Mass (Da):74,475
Checksum:i602F2F37E4F1ECC4
GO
Isoform Vint (identifier: Q9ERB4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2697-2738: PSAYQRTYSKKYLKNSSSVKDNSINTSKHEHRWSRRWQETRR → RKWSFRKNGQPCFNKY

Show »
Length:2,712
Mass (Da):296,869
Checksum:iCA94EDC94168EF2A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z9N6D3Z9N6_RAT
Versican core protein
Vcan
1,473Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D4A8Y6D4A8Y6_RAT
Versican core protein
Vcan
3,058Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3ZFC3D3ZFC3_RAT
Versican core protein
Vcan
507Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2K944A0A0G2K944_RAT
Versican core protein
Vcan
2,046Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section is used to indicate that two residues in a sequence are not consecutive and that there is an undetermined number of unsequenced residues between them.<p><a href='/help/non_cons' target='_top'>More...</a></p>Non-adjacent residuesi348 – 349Curated2
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2535 – 2539AEREC → NSARG (Ref. 4) Curated5

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_003091349 – 2431Missing in isoform V3. 1 PublicationAdd BLAST2083
Alternative sequenceiVSP_0030922697 – 2738PSAYQ…QETRR → RKWSFRKNGQPCFNKY in isoform Vint. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF062402 mRNA Translation: AAC40166.1
U75306 mRNA Translation: AAB51125.1
AF084544 mRNA Translation: AAD48544.1
AF072892 mRNA Translation: AAC26116.1
AY007691 mRNA Translation: AAG16631.1

NCBI Reference Sequences

More...
RefSeqi
NP_001164029.1, NM_001170558.1
NP_001164030.1, NM_001170559.1 [Q9ERB4-2]
NP_001164031.1, NM_001170560.1

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
114122

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:114122

UCSC genome browser

More...
UCSCi
RGD:619940 rat [Q9ERB4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062402 mRNA Translation: AAC40166.1
U75306 mRNA Translation: AAB51125.1
AF084544 mRNA Translation: AAD48544.1
AF072892 mRNA Translation: AAC26116.1
AY007691 mRNA Translation: AAG16631.1
RefSeqiNP_001164029.1, NM_001170558.1
NP_001164030.1, NM_001170559.1 [Q9ERB4-2]
NP_001164031.1, NM_001170560.1

3D structure databases

SMRiQ9ERB4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi250300, 1 interactor
STRINGi10116.ENSRNOP00000045935

PTM databases

PhosphoSitePlusiQ9ERB4

Proteomic databases

PaxDbiQ9ERB4
PRIDEiQ9ERB4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi114122
KEGGirno:114122
UCSCiRGD:619940 rat [Q9ERB4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1462
RGDi619940 Vcan

Phylogenomic databases

eggNOGiENOG410IFXS Eukaryota
ENOG410ZPDG LUCA
HOGENOMiHOG000168523
InParanoidiQ9ERB4
KOiK06793
OrthoDBi74642at2759
PhylomeDBiQ9ERB4

Enzyme and pathway databases

ReactomeiR-RNO-1971475 A tetrasaccharide linker sequence is required for GAG synthesis
R-RNO-2022870 Chondroitin sulfate biosynthesis
R-RNO-2022923 Dermatan sulfate biosynthesis
R-RNO-2024101 CS/DS degradation
R-RNO-3000178 ECM proteoglycans
R-RNO-381426 Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-RNO-8957275 Post-translational protein phosphorylation

Family and domain databases

CDDicd00033 CCP, 1 hit
cd03588 CLECT_CSPGs, 1 hit
Gene3Di2.60.40.10, 1 hit
3.10.100.10, 3 hits
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR033987 CSPG_CTLD
IPR016187 CTDL_fold
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR000538 Link_dom
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00008 EGF, 2 hits
PF00059 Lectin_C, 1 hit
PF00084 Sushi, 1 hit
PF07686 V-set, 1 hit
PF00193 Xlink, 2 hits
PRINTSiPR01265 LINKMODULE
SMARTiView protein in SMART
SM00032 CCP, 1 hit
SM00034 CLECT, 1 hit
SM00181 EGF, 2 hits
SM00179 EGF_CA, 2 hits
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SM00445 LINK, 2 hits
SUPFAMiSSF48726 SSF48726, 1 hit
SSF56436 SSF56436, 3 hits
SSF57535 SSF57535, 1 hit
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 1 hit
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 1 hit
PS50026 EGF_3, 2 hits
PS01187 EGF_CA, 1 hit
PS50835 IG_LIKE, 1 hit
PS01241 LINK_1, 2 hits
PS50963 LINK_2, 2 hits
PS50923 SUSHI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCSPG2_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9ERB4
Secondary accession number(s): O08592, O88564, Q9R1K4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: September 26, 2001
Last modified: June 5, 2019
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again