Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9EQR3 (KCNN1_MOUSE)

Entry version 154 (10 Feb 2021)
Sequence version 2 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Small conductance calcium-activated potassium channel protein 1

Gene

Kcnn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Ion channel
Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-1296052, Ca2+ activated K+ channels

Protein family/group databases

Transport Classification Database

More...TCDBi		9.A.48.1.1, the unconventional protein secretion (ups) system

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Small conductance calcium-activated potassium channel protein 1
Short name:
SK1
Short name:
SKCa 1
Short name:
SKCa1
Alternative name(s):
KCa2.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kcnn1
Synonyms:Sk1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1933993, Kcnn1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei108 – 128Helical; Name=Segment S1Sequence analysisAdd BLAST21
Transmembranei137 – 157Helical; Name=Segment S2Sequence analysisAdd BLAST21
Transmembranei176 – 196Helical; Name=Segment S3Sequence analysisAdd BLAST21
Transmembranei225 – 245Helical; Name=Segment S4Sequence analysisAdd BLAST21
Transmembranei274 – 294Helical; Name=Segment S5Sequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei314 – 334Pore-forming; Name=Segment H5Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001550081 – 537Small conductance calcium-activated potassium channel protein 1Add BLAST537

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9EQR3

PeptideAtlas

More...PeptideAtlasi		Q9EQR3

PRoteomics IDEntifications database

More...PRIDEi		Q9EQR3

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9EQR3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in brain and liver with lower levels in heart, testis, kidney and colon. In colon, detected in smooth muscle cells. Expressed in atrial and ventricular myocytes with higher levels in atrial myocytes.2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterooligomer. The complex is composed of 4 channel subunits each of which binds to a calmodulin subunit which regulates the channel activity through calcium-binding (By similarity).

Interacts with calmodulin.

By similarity1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		219999, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000105708

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9EQR3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9EQR3

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni343 – 363Segment S6Sequence analysisAdd BLAST21
Regioni381 – 460Calmodulin-bindingBy similarityAdd BLAST80

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi64 – 75Poly-GluAdd BLAST12

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the potassium channel KCNN family. KCa2.1/KCNN1 subfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3684, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9EQR3

Database of Orthologous Groups

More...OrthoDBi		907751at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9EQR3

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004178, CaM-bd_dom
IPR036122, CaM-bd_dom_sf
IPR015449, K_chnl_Ca-activ_SK
IPR013099, K_chnl_dom

The PANTHER Classification System

More...PANTHERi		PTHR10153, PTHR10153, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02888, CaMBD, 1 hit
PF07885, Ion_trans_2, 1 hit
PF03530, SK_channel, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01451, SKCHANNEL

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01053, CaMBD, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF81327, SSF81327, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: At least 16 isoforms may be produced by combinatorial splicing of the N-terminal exon 3.1 and the C-terminal exons 7, 8a and 9. Experimental confirmation may be lacking for some isoforms.

This entry has 9 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9EQR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSHSHNGSV GQPLGSGPGF LGWEPVDPEA GRPLQPTQGP GLQMVAKGQP 
        60         70         80         90        100
VRLSPGGSRG HPQEQEEEEE EEEEEDKTGS GKPPTVSHRL GHRRALFEKR 
       110        120        130        140        150
KRLSDYALIF GMFGIVVMVT ETELSWGVYT KESLCSFALK CLISLSTVIL 
       160        170        180        190        200
LGLVILYHAR EIQLFLVDNG ADDWRIAMTW ERVSLISLEL VVCAIHPVPG 
       210        220        230        240        250
HYRFTWTARL AFSLVPSAAE ADLDVLLSIP MFLRLYLLAR VMLLHSRIFT 
       260        270        280        290        300
DASSRSIGAL NRVTFNTRFV TKTLMTICPG TVLLVFSVSS WIVAAWTVRV 
       310        320        330        340        350
CERYHDKQEV TSNFLGAMWL ISITFLSIGY GDMVPHTYCG KGVCLLTGIM 
       360        370        380        390        400
GAGCTALVVA VVARKLELTK AEKHVHNFMM DTQLTKRVKN AAANVLRETW 
       410        420        430        440        450
LIYKHTRLVK KPDQGRVRKH QRKFLQAIHQ AQKLRSVKIE QGKVNDQANT 
       460        470        480        490        500
LAELAKAQSI AYEVVSELQA QQEELEARLA ALESRLDVLG ASLQALPGLI 
       510        520        530 
AQAICPLPPP WPGPGHLATA THSPQSHWLP TMGSDCG
Note: Produced by alternative splicing events in which various combinations of the four 5' non-coding exons A, B1, B2 or C are joined directly to exon 3.2.
Length:537
Mass (Da):59,330
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3DCFCB9FF309A4F
GO
Isoform 2 (identifier: Q9EQR3-2) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPSPRRQVAM

Show »
Length:580
Mass (Da):64,066
Checksum:i7B30C8A28B349C80
GO
Isoform 3 (identifier: Q9EQR3-3) [UniParc]FASTAAdd to basket
Also known as: V

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.

Note: Reduced calmodulin-binding.Curated
Show »
Length:500
Mass (Da):55,280
Checksum:iE258B479A7B58DB0
GO
Isoform 4 (identifier: Q9EQR3-4) [UniParc]FASTAAdd to basket
Also known as: VI

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     431-433: Missing.

Note: Reduced calmodulin-binding.Curated
Show »
Length:497
Mass (Da):54,953
Checksum:i5BB34F1EC2247C09
GO
Isoform 5 (identifier: Q9EQR3-5) [UniParc]FASTAAdd to basket
Also known as: VII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.Curated
Show »
Length:391
Mass (Da):43,675
Checksum:i3485373BF7622FB4
GO
Isoform 6 (identifier: Q9EQR3-6) [UniParc]FASTAAdd to basket
Also known as: VIII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.Curated
Show »
Length:388
Mass (Da):43,318
Checksum:i7C9860BFB4752E1F
GO
Isoform 7 (identifier: Q9EQR3-7) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.Curated
Show »
Length:425
Mass (Da):47,368
Checksum:i188D127F36CE9F86
GO
Isoform 8 (identifier: Q9EQR3-8) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.Curated
Show »
Length:428
Mass (Da):47,725
Checksum:iCE21486FE210EF36
GO
Isoform 9 (identifier: Q9EQR3-9) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     431-433: Missing.

Show »
Length:534
Mass (Da):59,002
Checksum:i3BEBCA093D392E3F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A140T8Q8A0A140T8Q8_MOUSE
Small conductance calcium-activated...
Kcnn1
538Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Z4YL28Z4YL28_MOUSE
Small conductance calcium-activated...
Kcnn1
539Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMB2A0A1D5RMB2_MOUSE
Small conductance calcium-activated...
Kcnn1
535Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLR9A0A1D5RLR9_MOUSE
Small conductance calcium-activated...
Kcnn1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLS4A0A1D5RLS4_MOUSE
Small conductance calcium-activated...
Kcnn1
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMF8A0A1D5RMF8_MOUSE
Small conductance calcium-activated...
Kcnn1
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RM38A0A1D5RM38_MOUSE
Small conductance calcium-activated...
Kcnn1
581Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The poly-Glu region of KCNN1 is polymorphic and the number of Glu varies between strains (from 10 to 12). The repeat with 10 Glu residues (shown here) is found in BALB/c, DBA/2J, 129/SvJ, A/J, C3H/HeJ, BALB/cJ, BXD-31, SM/J, ST/BJ, FVB/NJ, NZB/B1NJ, CBA/J and CAST/Ei.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti66E → EE in strain: C57BL/6J, A/HeJ and SPRET/Ei. 1 Publication1
Natural varianti66E → EEE in strain: SWR/J, AKR/J, RBF/DNJ and P/J. 1
Natural varianti522H → Q in strain: C57BL/6J. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0028091M → MFWNGQGDVQPLLSPQVHSE ALLRNHAGPQRACCTPSPRR QVAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_002810351 – 387Missing in isoform 3, isoform 4, isoform 5 and isoform 6. CuratedAdd BLAST37
Alternative sequenceiVSP_002811423 – 537KFLQA…GSDCG → LRSSEV in isoform 5 and isoform 8. CuratedAdd BLAST115
Alternative sequenceiVSP_002812423 – 537KFLQA…GSDCG → SEV in isoform 6 and isoform 7. CuratedAdd BLAST115
Alternative sequenceiVSP_002813431 – 433Missing in isoform 4 and isoform 9. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF116525 mRNA Translation: AAG43216.1
AF297870, AF297869 Genomic DNA Translation: AAK30363.1
AF303461 mRNA Translation: AAK29550.1
AF303462 mRNA Translation: AAK29551.1
AF303463 mRNA Translation: AAK29552.1
AF357239 mRNA Translation: AAK48900.1
AY258143 mRNA Translation: AAP45948.1
BC090622 mRNA Translation: AAH90622.1

NCBI Reference Sequences

More...RefSeqi		NP_115773.2, NM_032397.2
XP_006509870.1, XM_006509807.3
XP_006509871.1, XM_006509808.3

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84036

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:84036

UCSC genome browser

More...UCSCi		uc012gfj.1, mouse [Q9EQR3-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116525 mRNA Translation: AAG43216.1
AF297870, AF297869 Genomic DNA Translation: AAK30363.1
AF303461 mRNA Translation: AAK29550.1
AF303462 mRNA Translation: AAK29551.1
AF303463 mRNA Translation: AAK29552.1
AF357239 mRNA Translation: AAK48900.1
AY258143 mRNA Translation: AAP45948.1
BC090622 mRNA Translation: AAH90622.1
RefSeqiNP_115773.2, NM_032397.2
XP_006509870.1, XM_006509807.3
XP_006509871.1, XM_006509808.3

3D structure databases

SMRiQ9EQR3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi219999, 1 interactor
STRINGi10090.ENSMUSP00000105708

Protein family/group databases

TCDBi9.A.48.1.1, the unconventional protein secretion (ups) system

PTM databases

PhosphoSitePlusiQ9EQR3

Proteomic databases

PaxDbiQ9EQR3
PeptideAtlasiQ9EQR3
PRIDEiQ9EQR3

Genome annotation databases

GeneIDi84036
KEGGimmu:84036
UCSCiuc012gfj.1, mouse [Q9EQR3-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3780
MGIiMGI:1933993, Kcnn1

Phylogenomic databases

eggNOGiKOG3684, Eukaryota
InParanoidiQ9EQR3
OrthoDBi907751at2759
PhylomeDBiQ9EQR3

Enzyme and pathway databases

ReactomeiR-MMU-1296052, Ca2+ activated K+ channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84036, 3 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Kcnn1, mouse

Protein Ontology

More...PROi		PR:Q9EQR3
RNActiQ9EQR3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Family and domain databases

InterProiView protein in InterPro
IPR004178, CaM-bd_dom
IPR036122, CaM-bd_dom_sf
IPR015449, K_chnl_Ca-activ_SK
IPR013099, K_chnl_dom
PANTHERiPTHR10153, PTHR10153, 1 hit
PfamiView protein in Pfam
PF02888, CaMBD, 1 hit
PF07885, Ion_trans_2, 1 hit
PF03530, SK_channel, 1 hit
PRINTSiPR01451, SKCHANNEL
SMARTiView protein in SMART
SM01053, CaMBD, 1 hit
SUPFAMiSSF81327, SSF81327, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNN1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9EQR3
Secondary accession number(s): Q5CZY7, Q6JXY1, Q99JA9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: January 23, 2007
Last modified: February 10, 2021
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again