Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein O-GlcNAcase

Gene

Oga

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cleaves GlcNAc but not GalNAc from O-glycosylated proteins. Can use p-nitrophenyl-beta-GlcNAc and 4-methylumbelliferone-GlcNAc as substrates but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc (in vitro) (PubMed:16517082). Does not bind acetyl-CoA and does not have histone acetyltransferase activity.By similarity1 Publication

Caution

Was initially identified as a bi-functional protein that has an N-terminal domain with O-GlcNAcase activity and a C-terminal domain with histone acetyltransferase activity (PubMed:16356930). The histone acetyltransferase activity was detected only when the protein was expressed in mammalian cells, but not when expressed in bacterial cells, suggesting that the histone acetyltransferase activity might be due to the presence of a contaminant. Characterization of the human protein shows that this protein does not bind acetyl-CoA and therefore cannot have acetyltransferase activity.Curated

Catalytic activityi

[Protein]-3-O-(N-acetyl-beta-D-glucosaminyl)-L-serine + H2O = [protein]-L-serine + N-acetyl-D-glucosamine.1 Publication
[Protein]-3-O-(N-acetyl-beta-D-glucosaminyl)-L-threonine + H2O = [protein]-L-threonine + N-acetyl-D-glucosamine.1 Publication

Kineticsi

  1. KM=0.49 mM for pNP-GlcNAc1 Publication

    pH dependencei

    Optimum pH is 6.5-7.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Binding sitei67Substrate; via carbonyl oxygenBy similarity1
    Binding sitei98SubstrateBy similarity1
    Binding sitei174Substrate1 Publication1
    Active sitei175Proton donorBy similarity1
    Binding sitei219SubstrateBy similarity1
    Binding sitei285SubstrateBy similarity1
    Binding sitei313SubstrateBy similarity1

    GO - Molecular functioni

    GO - Biological processi

    Keywordsi

    Molecular functionGlycosidase, Hydrolase

    Enzyme and pathway databases

    BRENDAi2.3.1.48 3474
    3.2.1.169 3474

    Protein family/group databases

    CAZyiGH84 Glycoside Hydrolase Family 84
    MoonProtiQ9EQQ9

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein O-GlcNAcase1 PublicationCurated (EC:3.2.1.1691 Publication)
    Short name:
    OGA
    Alternative name(s):
    Beta-N-acetylhexosaminidase
    Beta-hexosaminidase
    Bifunctional protein NCOAT2 Publications
    Meningioma-expressed antigen 51 Publication
    N-acetyl-beta-D-glucosaminidase
    N-acetyl-beta-glucosaminidase
    Gene namesi
    Name:OgaBy similarity
    Synonyms:Hexc, Kiaa0679, Mgea5
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
    Proteomesi
    • UP000000589 Componenti: Chromosome 19

    Organism-specific databases

    MGIiMGI:1932139 Mgea5

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi166C → S: No change in substrate affinity but 60% reduction in O-GlcNAcase activity. 1 Publication1
    Mutagenesisi174D → N: 2-fold increase in substrate affinity and 77% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. No recovery of activity in the presence of sodium azide. 1 Publication1
    Mutagenesisi175D → A: 3-fold increase in substrate affinity and 90% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. 70% recovery of activity in the presence of sodium azide. 1 Publication1
    Mutagenesisi177D → N: 2-fold decrease in substrate affinity and 96% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. 40% recovery of activity in the presence of sodium azide. 1 Publication1
    Mutagenesisi878C → S: No effect on O-GlcNAcase activity. 1 Publication1

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    ChainiPRO_00002521191 – 916Protein O-GlcNAcaseAdd BLAST916

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Modified residuei364PhosphoserineCombined sources1

    Post-translational modificationi

    Proteolytically cleaved by caspase-3 during apoptosis. The fragments interact with each other; cleavage does not decrease enzyme activity.By similarity

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sitei413 – 414Cleavage; by caspase-3By similarity2

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    EPDiQ9EQQ9
    PaxDbiQ9EQQ9
    PeptideAtlasiQ9EQQ9
    PRIDEiQ9EQQ9

    PTM databases

    iPTMnetiQ9EQQ9
    PhosphoSitePlusiQ9EQQ9

    Expressioni

    Developmental stagei

    Expressed throughout development from blastocyst stage to embryonic day 16.5.1 Publication

    Inductioni

    Expression in the liver oscillates in a circadian manner with peak levels at CT8-CT12.1 Publication

    Gene expression databases

    BgeeiENSMUSG00000025220 Expressed in 291 organ(s), highest expression level in saccule of membranous labyrinth
    CleanExiMM_MGEA5
    GenevisibleiQ9EQQ9 MM

    Interactioni

    Subunit structurei

    Monomer (By similarity). Interacts with CLOCK.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Hist4h4P628062EBI-8321615,EBI-299632

    Protein-protein interaction databases

    BioGridi217934, 4 interactors
    IntActiQ9EQQ9, 4 interactors
    MINTiQ9EQQ9
    STRINGi10090.ENSMUSP00000026243

    Structurei

    3D structure databases

    ProteinModelPortaliQ9EQQ9
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Regioni278 – 280Substrate bindingBy similarity3

    Sequence similaritiesi

    Belongs to the glycosyl hydrolase 84 family.Curated

    Phylogenomic databases

    eggNOGiKOG3698 Eukaryota
    ENOG410XPBQ LUCA
    GeneTreeiENSGT00390000007726
    HOVERGENiHBG053044
    InParanoidiQ9EQQ9
    KOiK15719
    OMAiWLGCRSQ
    OrthoDBiEOG091G02T9
    PhylomeDBiQ9EQQ9
    TreeFamiTF313732

    Family and domain databases

    InterProiView protein in InterPro
    IPR016181 Acyl_CoA_acyltransferase
    IPR011496 Beta-N-acetylglucosaminidase
    IPR017853 Glycoside_hydrolase_SF
    PfamiView protein in Pfam
    PF07555 NAGidase, 1 hit
    SUPFAMiSSF51445 SSF51445, 1 hit
    SSF55729 SSF55729, 1 hit

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q9EQQ9-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MVQKESQAAL EERESERNAN PAAASGASLE QSVAPAPGED NPSGAGAAAV
    60 70 80 90 100
    VGAAGGARRF LCGVVEGFYG RPWVMEQRKE LFRRLQKWEL NTYLYAPKDD
    110 120 130 140 150
    YKHRMFWREM YSVEEAEQLM TLISAAREYE IEFIYAISPG LDITFSNPKE
    160 170 180 190 200
    VSTLKRKLDQ VSQFGCRSFA LLFDDIDHNM CAADKEVFSS FAHAQVSITN
    210 220 230 240 250
    EIYQYLGEPE TFLFCPTEYC GTFCYPNVSQ SPYLRTVGEK LLPGIEVLWT
    260 270 280 290 300
    GPKVVSKEIP VESIEEVSKI IKRAPVIWDN IHANDYDQKR LFLGPYKGRS
    310 320 330 340 350
    TELIPRLKGV LTNPNCEFEA NYVAIHTLAT WYKSNMNGVR KDVVMTDSED
    360 370 380 390 400
    STVSIQIKLE NEGSDEDIET DVLYSPQMAL KLALTEWLQE FGVPHQYSSR
    410 420 430 440 450
    QVAHSGAKTS VVDGTPLVAA PSLNATTVVT TVYQEPIMSQ GAALSGEPSV
    460 470 480 490 500
    LTKEEEKKQP DEEPMDMVVE KQEEAEHKND NQILTEIVEA KMAEELRPMD
    510 520 530 540 550
    TDKESMAESK SPEMSMQEDC IPDVAPMQTD EQTQKEQFVP GPNEKPLYTA
    560 570 580 590 600
    EPVTLEDLQL LADLFYLPYE HGPKGAQMLR EFQWLRANSS VVSVNCKGKD
    610 620 630 640 650
    SEKIEEWRSR AAKFEEMCAL VMGMFTRLSN CANRTILYDM YSYVWDIKSI
    660 670 680 690 700
    MSMVKSFVQW LGCRSHSSAQ FLIGDQEPWA FRGGLAGEFQ RLLPIDGAND
    710 720 730 740 750
    LFFQPPPLTP TSKVYTIRPY FPKDEASVYK ICREMYDDGV GFPFQSQPDL
    760 770 780 790 800
    IGDKLVGGLL SLSLDYCFVL EDEDGICGYA LGTVDVTPFI KKCKISWIPF
    810 820 830 840 850
    MQEKYTKPNG DKELSEAEKI MLSFHEEQEV LPETFLANFP SLIKMDIHKK
    860 870 880 890 900
    VTDPSVAKSM MACLLSSLKA NGSRGAFCEV RPDDKRILEF YSKLGCFEIA
    910
    KMEGFPKDVV ILGRSL
    Length:916
    Mass (Da):103,162
    Last modified:October 1, 2001 - v2
    Checksum:iB2FAC6F10E03C5CA
    GO
    Isoform 2 (identifier: Q9EQQ9-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-698: Missing.
         699-725: NDLFFQPPPLTPTSKVYTIRPYFPKDE → MYTTHSCLYSFFLTFFLVCCLTRLYFQ

    Note: No experimental confirmation available.
    Show »
    Length:218
    Mass (Da):24,718
    Checksum:i48F3308C6C616896
    GO
    Isoform 3 (identifier: Q9EQQ9-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MVRPRVWRSSRRVASQNGLRAFGPTDRGRRGAVAGGRRM

    Note: No experimental confirmation available.
    Show »
    Length:954
    Mass (Da):107,395
    Checksum:i677AA03C422AECBD
    GO

    Sequence cautioni

    The sequence AAH41109 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
    The sequence BAC97998 differs from that shown. Reason: Erroneous initiation.Curated
    The sequence BAE26311 differs from that shown. Reason: Erroneous initiation.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti6S → T in BAE26311 (PubMed:16141072).Curated1
    Sequence conflicti52 – 53GA → RT in BAE26311 (PubMed:16141072).Curated2
    Sequence conflicti742F → S in BAC97998 (PubMed:14621295).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_0208701 – 698Missing in isoform 2. 1 PublicationAdd BLAST698
    Alternative sequenceiVSP_0208711M → MVRPRVWRSSRRVASQNGLR AFGPTDRGRRGAVAGGRRM in isoform 3. 1 Publication1
    Alternative sequenceiVSP_020872699 – 725NDLFF…FPKDE → MYTTHSCLYSFFLTFFLVCC LTRLYFQ in isoform 2. 1 PublicationAdd BLAST27

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF132214 mRNA Translation: AAG43273.2
    AK129188 mRNA Translation: BAC97998.1 Different initiation.
    BC041109 mRNA Translation: AAH41109.1 Sequence problems.
    BC054821 mRNA Translation: AAH54821.1
    AK012695 mRNA Translation: BAB28416.1
    AK014781 mRNA Translation: BAB29550.1
    AK077613 mRNA Translation: BAC36900.1
    AK088774 mRNA Translation: BAC40564.1
    AK145227 mRNA Translation: BAE26311.1 Different initiation.
    CCDSiCCDS29866.1 [Q9EQQ9-1]
    RefSeqiNP_076288.1, NM_023799.3 [Q9EQQ9-1]
    UniGeneiMm.122725
    Mm.435821
    Mm.440640
    Mm.480399

    Genome annotation databases

    EnsembliENSMUST00000026243; ENSMUSP00000026243; ENSMUSG00000025220 [Q9EQQ9-1]
    GeneIDi76055
    KEGGimmu:76055
    UCSCiuc008hrm.1 mouse [Q9EQQ9-2]
    uc008hrn.1 mouse [Q9EQQ9-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Similar proteinsi

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AF132214 mRNA Translation: AAG43273.2
    AK129188 mRNA Translation: BAC97998.1 Different initiation.
    BC041109 mRNA Translation: AAH41109.1 Sequence problems.
    BC054821 mRNA Translation: AAH54821.1
    AK012695 mRNA Translation: BAB28416.1
    AK014781 mRNA Translation: BAB29550.1
    AK077613 mRNA Translation: BAC36900.1
    AK088774 mRNA Translation: BAC40564.1
    AK145227 mRNA Translation: BAE26311.1 Different initiation.
    CCDSiCCDS29866.1 [Q9EQQ9-1]
    RefSeqiNP_076288.1, NM_023799.3 [Q9EQQ9-1]
    UniGeneiMm.122725
    Mm.435821
    Mm.440640
    Mm.480399

    3D structure databases

    ProteinModelPortaliQ9EQQ9
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi217934, 4 interactors
    IntActiQ9EQQ9, 4 interactors
    MINTiQ9EQQ9
    STRINGi10090.ENSMUSP00000026243

    Protein family/group databases

    CAZyiGH84 Glycoside Hydrolase Family 84
    MoonProtiQ9EQQ9

    PTM databases

    iPTMnetiQ9EQQ9
    PhosphoSitePlusiQ9EQQ9

    Proteomic databases

    EPDiQ9EQQ9
    PaxDbiQ9EQQ9
    PeptideAtlasiQ9EQQ9
    PRIDEiQ9EQQ9

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENSMUST00000026243; ENSMUSP00000026243; ENSMUSG00000025220 [Q9EQQ9-1]
    GeneIDi76055
    KEGGimmu:76055
    UCSCiuc008hrm.1 mouse [Q9EQQ9-2]
    uc008hrn.1 mouse [Q9EQQ9-1]

    Organism-specific databases

    CTDi76055
    MGIiMGI:1932139 Mgea5
    RougeiSearch...

    Phylogenomic databases

    eggNOGiKOG3698 Eukaryota
    ENOG410XPBQ LUCA
    GeneTreeiENSGT00390000007726
    HOVERGENiHBG053044
    InParanoidiQ9EQQ9
    KOiK15719
    OMAiWLGCRSQ
    OrthoDBiEOG091G02T9
    PhylomeDBiQ9EQQ9
    TreeFamiTF313732

    Enzyme and pathway databases

    BRENDAi2.3.1.48 3474
    3.2.1.169 3474

    Miscellaneous databases

    ChiTaRSiMgea5 mouse
    PROiPR:Q9EQQ9
    SOURCEiSearch...

    Gene expression databases

    BgeeiENSMUSG00000025220 Expressed in 291 organ(s), highest expression level in saccule of membranous labyrinth
    CleanExiMM_MGEA5
    GenevisibleiQ9EQQ9 MM

    Family and domain databases

    InterProiView protein in InterPro
    IPR016181 Acyl_CoA_acyltransferase
    IPR011496 Beta-N-acetylglucosaminidase
    IPR017853 Glycoside_hydrolase_SF
    PfamiView protein in Pfam
    PF07555 NAGidase, 1 hit
    SUPFAMiSSF51445 SSF51445, 1 hit
    SSF55729 SSF55729, 1 hit
    ProtoNetiSearch...

    Entry informationi

    Entry nameiOGA_MOUSE
    AccessioniPrimary (citable) accession number: Q9EQQ9
    Secondary accession number(s): Q3ULY7
    , Q6ZQ71, Q8BK05, Q8BTT2, Q8CFX2, Q9CSJ4, Q9CUR7
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
    Last sequence update: October 1, 2001
    Last modified: September 12, 2018
    This is version 129 of the entry and version 2 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Glycosyl hydrolases
      Classification of glycosyl hydrolase families and list of entries
    2. SIMILARITY comments
      Index of protein domains and families
    3. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again