UniProtKB - Q9EQC4 (ELOV4_MOUSE)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
>sp|Q9EQC4|ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus OX=10090 GN=Elovl4 PE=1 SV=2 MGLLDSEPGSVLNAMSTAFNDTVEFYRWTWTIADKRVADWPLMQSPWPTISISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVN EVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSKTGKTATNGISSNGVNKSEKALEN GKPQKNGKPKGECommunity curation ()Add a publicationFeedback
Elongation of very long chain fatty acids protein 4
Elovl4
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi
6 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE. - Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi
- a very-long-chain acyl-CoAEC:2.3.1.199
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion according to rulesi
6 PublicationsManual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE. - Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
Manual assertion according to rulesi
6 PublicationsManual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE. - Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
a very-long-chain acyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=a very-long-chain 3-oxoacyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+hexacosanoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxooctacosanyol-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+octacosanoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-triacontanoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- H+
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+triacontanoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-dotriacontanoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (19Z,22Z,25Z,28Z,31Z)-tetratriacontapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(19Z,22Z,25Z,28Z,31Z)-tetratriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(21Z,24Z,27Z,30Z,33Z)-hexatriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (7Z,10Z,13Z,16Z)-docosatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion based on experiment ini
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion based on experiment ini
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(7Z,10Z,13Z,16Z)-docosatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=(9Z,12Z,15Z,18Z)-3-oxotetracosatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (11Z,14Z,17Z,20Z,23Z)-hexacosapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(11Z,14Z,17Z,20Z,23Z)-hexacosapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(13Z,16Z,19Z,22Z,25Z)-octacosapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (13Z,16Z,19Z,22Z,25Z)-octacosapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(13Z,16Z,19Z,22Z,25Z)-octacosapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(15Z,18Z,21Z,24Z,27Z)-triacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (15Z,18Z,21Z,24Z,27Z)-triacontapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(15Z,18Z,21Z,24Z,27Z)-triacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(17Z,20Z,23Z,26Z,29Z)-dotriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (17Z,20Z,23Z,26Z,29Z)-dotriacontapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(17Z,20Z,23Z,26Z,29Z)-dotriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(19Z,22Z,25Z,28Z,31Z)-tetratriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (21Z,24Z,27Z,30Z,33Z)-hexatriacontapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(21Z,24Z,27Z,30Z,33Z)-hexatriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(23Z,26Z,29Z,32Z,35Z)-octatriacontapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (11Z,14Z,17Z,20Z)-hexacosatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(11Z,14Z,17Z,20Z)-hexacosatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=(13Z,16Z,19Z,22Z)-3-oxooctacosatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (13Z,16Z,19Z,22Z)-octacosatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(13Z,16Z,19Z,22Z)-octacosatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(15Z,18Z,21Z,24Z)-triacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (15Z,18Z,21Z,24Z)-triacontatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(15Z,18Z,21Z,24Z)-triacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(17Z,20Z,23Z,26Z)-dotriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (17Z,20Z,23Z,26Z)-dotriacontatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(17Z,20Z,23Z,26Z)-dotriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(19Z,22Z,25Z,28Z)-tetratriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (19Z,22Z,25Z,28Z)-tetratriacontatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(19Z,22Z,25Z,28Z)-tetratriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(21Z,24Z,27Z,30Z)-hexatriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (21Z,24Z,27Z,30Z)-hexatriacontatetraenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(21Z,24Z,27Z,30Z)-hexatriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(23Z,26Z,29Z,32Z)-octatriacontatetraenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(6Z,9Z,12Z,15Z,18Z,21Z)-tetracosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(8Z,11Z,14Z,17Z,20Z,23Z)-hexacosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (8Z,11Z,14Z,17Z,20Z,23Z)-hexacosahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(8Z,11Z,14Z,17Z,20Z,23Z)-hexacosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(10Z,13Z,16Z,19Z,22Z,25Z)-octacosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (10Z,13Z,16Z,19Z,22Z,25Z)-octacosahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(10Z,13Z,16Z,19Z,22Z,25Z)-octacosahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(12Z,15Z,18Z,21Z,24Z,27Z)-triacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (12Z,15Z,18Z,21Z,24Z,27Z)-triacontahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(12Z,15Z,18Z,21Z,24Z,27Z)-triacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(14Z,17Z,20Z,23Z,26Z,29Z)-dotriacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (14Z,17Z,20Z,23Z,26Z,29Z)-dotriacontahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(14Z,17Z,20Z,23Z,26Z,29Z)-dotriacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(16Z,19Z,22Z,25Z,28Z,31Z)-tetratriacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (16Z,19Z,22Z,25Z,28Z,31Z)-tetratriacontahexaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(16Z,19Z,22Z,25Z,28Z,31Z)-tetratriacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(18Z,21Z,24Z,27Z,30Z,33Z)-hexatriacontahexaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- (9Z,12Z,15Z,18Z,21Z)-tetracosapentaenoyl-CoA
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
This reaction proceeds in the forward- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
Manual assertion inferred by curator fromi
- Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY.
Source: Rhea- Search for this reaction in UniProtKB.
- See the description of this reaction in Rhea.
(9Z,12Z,15Z,18Z,21Z)-tetracosapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+H+- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+malonyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
=3-oxo-(11Z,14Z,17Z,20Z,23Z)-hexacosapentaenoyl-CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
zoom
+CO2- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
+CoA- Search proteins in UniProtKB for this molecule.
- Search chemical reactions in Rhea for this molecule.
- See the description of this molecule in ChEBI.
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: fatty acid biosynthesis
This protein is involved in the pathway fatty acid biosynthesis, which is part of Lipid metabolism.UniRule annotationManual assertion according to rulesi
6 PublicationsManual assertion based on experiment ini
- Ref.6"Role of Stargardt-3 macular dystrophy protein (ELOVL4) in the biosynthesis of very long chain fatty acids."
Agbaga M.P., Brush R.S., Mandal M.N., Henry K., Elliott M.H., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 105:12843-12848(2008) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.7"Essential role of ELOVL4 protein in very long chain fatty acid synthesis and retinal function."
Harkewicz R., Du H., Tong Z., Alkuraya H., Bedell M., Sun W., Wang X., Hsu Y.H., Esteve-Rudd J., Hughes G., Su Z., Zhang M., Lopes V.S., Molday R.S., Williams D.S., Dennis E.A., Zhang K.
J. Biol. Chem. 287:11469-11480(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.8"ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3."
Yu M., Benham A., Logan S., Brush R.S., Mandal M.N., Anderson R.E., Agbaga M.P.
J. Lipid Res. 53:494-504(2012) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY. - Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE. - Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
View all proteins of this organism that are known to be involved in the pathway fatty acid biosynthesis and in Lipid metabolism.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- 3-oxo-arachidoyl-CoA synthase activity Source: UniProtKB-EC
- 3-oxo-cerotoyl-CoA synthase activity Source: UniProtKB-EC
- 3-oxo-lignoceronyl-CoA synthase activity Source: UniProtKB-EC
- fatty acid elongase activity Source: UniProtKB
<p>Inferred from Mutant Phenotype</p>
<p>Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#imp">GO evidence code guide</a></p>
Inferred from mutant phenotypei
- Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE.
- very-long-chain 3-ketoacyl-CoA synthase activity Source: UniProtKB-EC
GO - Biological processi
- fatty acid elongation, monounsaturated fatty acid Source: GO_Central
<p>Inferred from Biological aspect of Ancestor</p>
<p>A type of phylogenetic evidence whereby an aspect of a descendent is inferred through the characterization of an aspect of a ancestral gene.</p>
<p>More information in the <a href="http://geneontology.org/page/guide%2Dgo%2Devidence%2Dcodes#iba">GO evidence code guide</a></p>
Inferred from biological aspect of ancestori
- "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium."
Gaudet P., Livstone M.S., Lewis S.E., Thomas P.D.
Brief Bioinform 12:449-462(2011) [PubMed] [Europe PMC] [Abstract]
- fatty acid elongation, polyunsaturated fatty acid Source: UniProtKBInferred from mutant phenotypei
- Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE.
- fatty acid elongation, saturated fatty acid Source: UniProtKB
- long-chain fatty-acyl-CoA biosynthetic process Source: UniProtKB-UniRule
- sphingolipid biosynthetic process Source: GO_CentralInferred from biological aspect of ancestori
- "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium."
Gaudet P., Livstone M.S., Lewis S.E., Thomas P.D.
Brief Bioinform 12:449-462(2011) [PubMed] [Europe PMC] [Abstract]
- unsaturated fatty acid biosynthetic process Source: UniProtKB-UniRule
- very long-chain fatty acid biosynthetic process Source: UniProtKB
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
Molecular function | Transferase |
Biological process | Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism |
Enzyme and pathway databases
UniPathway: a resource for the exploration and annotation of metabolic pathways More...UniPathwayi | UPA00094 |
Chemistry databases
SwissLipids knowledge resource for lipid biology More...SwissLipidsi | SLP:000000264 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Elongation of very long chain fatty acids protein 4UniRule annotationManual assertion according to rulesi Curated (EC:2.3.1.199
Manual assertion according to rulesi 6 PublicationsManual assertion based on experiment ini
Alternative name(s): 3-keto acyl-CoA synthase Elovl4UniRule annotation Manual assertion according to rulesi ELOVL fatty acid elongase 4UniRule annotation Manual assertion according to rulesi Short name: ELOVL FA elongase 4UniRule annotation Manual assertion according to rulesi Very long chain 3-ketoacyl-CoA synthase 4UniRule annotation Manual assertion according to rulesi Very long chain 3-oxoacyl-CoA synthase 4UniRule annotation Manual assertion according to rulesi |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:Elovl4UniRule annotation Manual assertion according to rulesi |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Mus musculus (Mouse) |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 10090 [NCBI] |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus |
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Mouse genome database (MGD) from Mouse Genome Informatics (MGI) More...MGIi | MGI:1933331, Elovl4 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Endoplasmic reticulum
- Endoplasmic reticulum membrane UniRule annotation
Manual assertion according to rulesi
2 PublicationsManual assertion based on experiment ini
- Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
Manual assertion according to rulesi
- Endoplasmic reticulum membrane UniRule annotation
Endoplasmic reticulum
- endoplasmic reticulum Source: UniProtKB
- endoplasmic reticulum membrane Source: Reactome
- integral component of endoplasmic reticulum membrane Source: UniProtKB
Topology
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 42 – 62 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 78 – 98 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 127 – 147 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 165 – 185 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 188 – 208 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 217 – 237 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 | |
Transmembranei | 246 – 266 | HelicalUniRule annotation Manual assertion according to rulesi Add BLAST | 21 |
Keywords - Cellular componenti
Endoplasmic reticulum, Membrane<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei
Manual assertion based on experiment ini
- Ref.9"Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration."
Barabas P., Liu A., Xing W., Chen C.K., Tong Z., Watt C.B., Jones B.W., Bernstein P.S., Krizaj D.
Proc. Natl. Acad. Sci. U.S.A. 110:5181-5186(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, DISRUPTION PHENOTYPE.
Mutagenesis
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 22 | T → A: Loss of N-glycosylation. No effect on fatty acid elongase activity. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 158 | H → Q: Loss of fatty acid elongase activity. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 161 | H → Q: Loss of fatty acid elongase activity. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 162 | H → Q: Loss of fatty acid elongase activity. 1 Publication Manual assertion based on experiment ini
| 1 | |
Mutagenesisi | 308 – 310 | KPK → RKR: Loss of localization to the endoplasmic reticulum. Loss of fatty acid elongase activity. 1 Publication Manual assertion based on experiment ini
| 3 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000207545 | 1 – 312 | Elongation of very long chain fatty acids protein 4Add BLAST | 312 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi | 20 | N-linked (GlcNAc...) asparagineUniRule annotation Manual assertion according to rulesi | 1 | |
Glycosylationi | 292 | N-linked (GlcNAc...) asparagineUniRule annotation Manual assertion according to rulesi | 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
Manual assertion based on experiment ini
- Ref.10"Deciphering mutant ELOVL4 activity in autosomal-dominant Stargardt macular dystrophy."
Logan S., Agbaga M.P., Chan M.D., Kabir N., Mandal N.A., Brush R.S., Anderson R.E.
Proc. Natl. Acad. Sci. U.S.A. 110:5446-5451(2013) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, SUBCELLULAR LOCATION, GLYCOSYLATION. - Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
Keywords - PTMi
GlycoproteinProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | Q9EQC4 |
PRoteomics IDEntifications database More...PRIDEi | Q9EQC4 |
PTM databases
GlyConnect protein glycosylation platform More...GlyConnecti | 2280, 1 N-Linked glycan (1 site) |
GlyGen: Computational and Informatics Resources for Glycoscience More...GlyGeni | Q9EQC4, 2 sites |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | Q9EQC4 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Manual assertion based on experiment ini
- Ref.2"Characterization of mouse orthologue of ELOVL4: genomic organization and spatial and temporal expression."
Mandal M.N., Ambasudhan R., Wong P.W., Gage P.J., Sieving P.A., Ayyagari R.
Genomics 83:626-635(2004) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei
Manual assertion based on experiment ini
- Ref.2"Characterization of mouse orthologue of ELOVL4: genomic organization and spatial and temporal expression."
Mandal M.N., Ambasudhan R., Wong P.W., Gage P.J., Sieving P.A., Ayyagari R.
Genomics 83:626-635(2004) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSMUSG00000032262, Expressed in skin of external ear and 228 other tissues |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | Q9EQC4, baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | Q9EQC4, MM |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Oligomer.
UniRule annotationManual assertion according to rulesi
Protein-protein interaction databases
STRING: functional protein association networks More...STRINGi | 10090.ENSMUSP00000034796 |
Miscellaneous databases
RNAct, Protein-RNA interaction predictions for model organisms. More...RNActi | Q9EQC4, protein |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | Q9EQC4 |
Database of comparative protein structure models More...ModBasei | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Motif
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 308 – 312 | Di-lysine motifUniRule annotation Manual assertion according to rulesi 1 PublicationManual assertion based on experiment ini
| 5 |
<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini
Manual assertion according to rulesi
1 PublicationManual assertion based on experiment ini
- Ref.11"Endoplasmic reticulum microenvironment and conserved histidines govern ELOVL4 fatty acid elongase activity."
Logan S., Agbaga M.P., Chan M.D., Brush R.S., Anderson R.E.
J. Lipid Res. 55:698-708(2014) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, CATALYTIC ACTIVITY, PATHWAY, MUTAGENESIS OF THR-22; HIS-158; HIS-161; HIS-162 AND 308-LYS--LYS-310, SUBCELLULAR LOCATION, GLYCOSYLATION, MOTIF.
<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Keywords - Domaini
Transmembrane, Transmembrane helixPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG3071, Eukaryota |
Ensembl GeneTree More...GeneTreei | ENSGT01000000214427 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | CLU_048483_0_1_1 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | Q9EQC4 |
Identification of Orthologs from Complete Genome Data More...OMAi | SIYIDCP |
Database of Orthologous Groups More...OrthoDBi | 1094172at2759 |
TreeFam database of animal gene trees More...TreeFami | TF323454 |
Family and domain databases
HAMAP database of protein families More...HAMAPi | MF_03204, VLCF_elongase_4, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR030457, ELO_CS IPR002076, ELO_fam IPR033678, ELOVL4 |
The PANTHER Classification System More...PANTHERi | PTHR11157, PTHR11157, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF01151, ELO, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01188, ELO, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequence (1+)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show allAlign All
10 20 30 40 50
MGLLDSEPGS VLNAMSTAFN DTVEFYRWTW TIADKRVADW PLMQSPWPTI
60 70 80 90 100
SISTLYLLFV WLGPKWMKDR EPFQMRLVLI IYNFGMVLLN LFIFRELFMG
110 120 130 140 150
SYNAGYSYIC QSVDYSNDVN EVRIAGALWW YFVSKGVEYL DTVFFILRKK
160 170 180 190 200
NNQVSFLHVY HHCTMFTLWW IGIKWVAGGQ AFFGAQMNSF IHVIMYSYYG
210 220 230 240 250
LTAFGPWIQK YLWWKRYLTM LQLVQFHVTI GHTALSLYTD CPFPKWMHWA
260 270 280 290 300
LIAYAISFIF LFLNFYTRTY NEPKQSKTGK TATNGISSNG VNKSEKALEN
310
GKPQKNGKPK GE
<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi
There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basketEntry | Entry name | Protein names | Gene names | Length | Annotation | ||
---|---|---|---|---|---|---|---|
V9GXI2 | V9GXI2_MOUSE | Elongation of very long chain fatty... Elongation of very long chain fatty acids protein, EC 2.3.1.199 (Very-long-chain 3-oxoacyl-CoA synthase) | Elovl4 | 181 | Annotation score: Annotation score:3 out of 5 <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p> |
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 126 | G → A in AAG47667 (PubMed:11138005).Curated | 1 |
Sequence databases
Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | AF277093 mRNA Translation: AAG47667.1 AJ550628 , AJ550629, AJ550630, AJ550631, AJ550632, AJ550633 Genomic DNA Translation: CAD80158.4 AK029065 mRNA Translation: BAC26274.1 CH466522 Genomic DNA Translation: EDL26470.1 BC037030 mRNA Translation: AAH37030.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS23376.1 |
NCBI Reference Sequences More...RefSeqi | NP_683743.2, NM_148941.2 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENSMUST00000034796; ENSMUSP00000034796; ENSMUSG00000032262 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 83603 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | mmu:83603 |
UCSC genome browser More...UCSCi | uc012gxk.1, mouse |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | AF277093 mRNA Translation: AAG47667.1 AJ550628 , AJ550629, AJ550630, AJ550631, AJ550632, AJ550633 Genomic DNA Translation: CAD80158.4 AK029065 mRNA Translation: BAC26274.1 CH466522 Genomic DNA Translation: EDL26470.1 BC037030 mRNA Translation: AAH37030.1 |
CCDSi | CCDS23376.1 |
RefSeqi | NP_683743.2, NM_148941.2 |
3D structure databases
SMRi | Q9EQC4 |
ModBasei | Search... |
Protein-protein interaction databases
STRINGi | 10090.ENSMUSP00000034796 |
Chemistry databases
SwissLipidsi | SLP:000000264 |
PTM databases
GlyConnecti | 2280, 1 N-Linked glycan (1 site) |
GlyGeni | Q9EQC4, 2 sites |
PhosphoSitePlusi | Q9EQC4 |
Proteomic databases
PaxDbi | Q9EQC4 |
PRIDEi | Q9EQC4 |
Protocols and materials databases
Antibodypedia a portal for validated antibodies More...Antibodypediai | 31608, 232 antibodies |
Genome annotation databases
Ensembli | ENSMUST00000034796; ENSMUSP00000034796; ENSMUSG00000032262 |
GeneIDi | 83603 |
KEGGi | mmu:83603 |
UCSCi | uc012gxk.1, mouse |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 6785 |
MGIi | MGI:1933331, Elovl4 |
Phylogenomic databases
eggNOGi | KOG3071, Eukaryota |
GeneTreei | ENSGT01000000214427 |
HOGENOMi | CLU_048483_0_1_1 |
InParanoidi | Q9EQC4 |
OMAi | SIYIDCP |
OrthoDBi | 1094172at2759 |
TreeFami | TF323454 |
Enzyme and pathway databases
UniPathwayi | UPA00094 |
Miscellaneous databases
BioGRID ORCS database of CRISPR phenotype screens More...BioGRID-ORCSi | 83603, 1 hit in 17 CRISPR screens |
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | Elovl4, mouse |
Protein Ontology More...PROi | PR:Q9EQC4 |
RNActi | Q9EQC4, protein |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgeei | ENSMUSG00000032262, Expressed in skin of external ear and 228 other tissues |
ExpressionAtlasi | Q9EQC4, baseline and differential |
Genevisiblei | Q9EQC4, MM |
Family and domain databases
HAMAPi | MF_03204, VLCF_elongase_4, 1 hit |
InterProi | View protein in InterPro IPR030457, ELO_CS IPR002076, ELO_fam IPR033678, ELOVL4 |
PANTHERi | PTHR11157, PTHR11157, 1 hit |
Pfami | View protein in Pfam PF01151, ELO, 1 hit |
PROSITEi | View protein in PROSITE PS01188, ELO, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | ELOV4_MOUSE | |
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q9EQC4Primary (citable) accession number: Q9EQC4 Secondary accession number(s): Q8JZV3 | |
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | January 23, 2002 |
Last sequence update: | July 27, 2011 | |
Last modified: | December 2, 2020 | |
This is version 132 of the entry and version 2 of the sequence. See complete history. | ||
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program |
<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
Keywords - Technical termi
Reference proteomeDocuments
- MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot - PATHWAY comments
Index of metabolic and biosynthesis pathways - SIMILARITY comments
Index of protein domains and families