Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (07 Apr 2021)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

cAMP-regulated phosphoprotein 21

Gene

Arpp21

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-regulated phosphoprotein 21
Short name:
ARPP-21
Alternative name(s):
Regulator of calmodulin signaling
Thymocyte cAMP-regulated phosphoprotein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Arpp21
Synonyms:Rcs, Tarpp
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107562, Arpp21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi650R → A: Abolishes methylation, no effect on subcellular location. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000646832 – 807cAMP-regulated phosphoprotein 21Add BLAST806

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei32PhosphoserineCombined sources1
Modified residuei55Phosphoserine; by PKA2 Publications1
Modified residuei133PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei361PhosphoserineCombined sources1
Modified residuei381PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei650Asymmetric dimethylarginine1 Publication1
Isoform 4 (identifier: Q9DCB4-4)
Modified residuei265PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation of isoform 2 at Ser-55 is enhanced upon dopamine D1 receptor activation and favors interaction with CALM1.2 Publications
Methylated by CARM1 at Arg-650 in immature thymocytes.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9DCB4

PeptideAtlas

More...
PeptideAtlasi
Q9DCB4

PRoteomics IDEntifications database

More...
PRIDEi
Q9DCB4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
283233 [Q9DCB4-1]
283234 [Q9DCB4-2]
283235 [Q9DCB4-3]
283236 [Q9DCB4-4]
283237 [Q9DCB4-5]
283238 [Q9DCB4-6]
283239 [Q9DCB4-7]
283240 [Q9DCB4-8]
283241 [Q9DCB4-9]
283242 [Q9DCB4-10]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9DCB4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9DCB4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present at high levels in thymus and low levels in brain. In thymus, isoform 1 is specifically found in immature thymocytes (at protein level).1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Down-regulated in thymocytes upon TCR engagement (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000032503, Expressed in caudate-putamen and 210 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9DCB4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9DCB4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CALM1.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
216492, 1 interactor

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9DCB4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9DCB4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini163 – 226R3HPROSITE-ProRule annotationAdd BLAST64
Domaini227 – 298SUZPROSITE-ProRule annotationAdd BLAST72

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili32 – 57Sequence analysisAdd BLAST26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi335 – 433Ser-richAdd BLAST99
Compositional biasi502 – 749Gln-richAdd BLAST248

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160796

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007817_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9DCB4

Identification of Orthologs from Complete Genome Data

More...
OMAi
ANCRTNC

Database of Orthologous Groups

More...
OrthoDBi
137913at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9DCB4

TreeFam database of animal gene trees

More...
TreeFami
TF315915

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1370.50, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001374, R3H_dom
IPR036867, R3H_dom_sf
IPR024771, SUZ

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01424, R3H, 1 hit
PF12752, SUZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00393, R3H, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF82708, SSF82708, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51061, R3H, 1 hit
PS51673, SUZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9DCB4-1) [UniParc]FASTAAdd to basket
Also known as: TARPP

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEQGGLTPT ILEEGQTEPE SAPENGILKS ESLDEEEKLE LQRRLAAQNQ
60 70 80 90 100
ERRKSKSGAG KGKLTRSLAV CEESSARSGG ESHQDQESIH LQLSSFPSLQ
110 120 130 140 150
EEDKSRKDDS EREKEKDKNR EKLSERPKIR MLSKDCSQEY TDSTGIDLHG
160 170 180 190 200
FLINTLKNNS RDRMILLKME QEMIDFIADS NNHYKKFPQM SSYQRMLVHR
210 220 230 240 250
VAAYFGLDHN VDQTGKSVII NKTSSTRIPE QRFCEHLKDE KSEESQKRFI
260 270 280 290 300
LKRDNSSIDK EDNQNRMHPF RDDRRSKSIE EREEEYQRVR ERIFAHDSVC
310 320 330 340 350
SQESLFLDNS RLQEDMHICN ETYKKRQLFR AHRDSSGRTS GSRQSSSETE
360 370 380 390 400
LRWPDHQRAW SSTDSDSSNR NLKPTMTKTA SFGGITVLTR GDSTSSTRSA
410 420 430 440 450
GKLSKTGSES SSSAGSSGSL SRTHPQSTAL TSSVAAGSPG CMAYSENGMG
460 470 480 490 500
GQVPPSSTSY ILLPLESATG IPPGSILLNP HTGQPFVNPD GTPAIYNPPG
510 520 530 540 550
SQQTLRGTVG GQPQQPPQQQ PSPQPQQQVQ ASQPQMAGPL VTQREELAAQ
560 570 580 590 600
FSQLSMSRQS SGDTPEPPSG TVYPASLLPQ TAQPQSYVIT SAGQQLSTGG
610 620 630 640 650
FSDSGPPISQ QVLQAPPSPQ GFVQQPPPAQ MSVYYYPSGQ YPTSTSQQYR
660 670 680 690 700
PLASVQYSAQ RSQQIPQTTQ QAGYQPVLSG QQGFQGMMGV QQSAHSQGVM
710 720 730 740 750
SSQQGAPVHG VMVSYPTMSS YQVPMTQGSQ AVPQQTYQPP IMLPSQAGQG
760 770 780 790 800
SLPATGMPVY CNVTPPNPQN NLRLMGPHCP SSTVPVMSAS CRTNCGNVSN

AGWQVKF
Length:807
Mass (Da):88,567
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99DD32A59954E139
GO
Isoform 2 (identifier: Q9DCB4-2) [UniParc]FASTAAdd to basket
Also known as: ARPP-21, RCS

The sequence of this isoform differs from the canonical sequence as follows:
     87-88: ES → TL
     89-807: Missing.

Show »
Length:88
Mass (Da):9,539
Checksum:iB9EC4A0A405C22CC
GO
Isoform 3 (identifier: Q9DCB4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.
     543-543: Q → QSVQSLQPSSQSVQYPAVSFPPQHLLPMSPTQHFPL

Show »
Length:809
Mass (Da):88,140
Checksum:i1932D4D307F452EA
GO
Isoform 4 (identifier: Q9DCB4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.
     310-329: Missing.
     543-543: Q → QSVQSLQPSSQSVQYPAVSFPPQHLLPMSPTQHFPL

Show »
Length:789
Mass (Da):85,618
Checksum:iB98D052B4608DC93
GO
Isoform 5 (identifier: Q9DCB4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.

Show »
Length:774
Mass (Da):84,296
Checksum:iD7EA63794D374082
GO
Isoform 6 (identifier: Q9DCB4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: I → M
     229-807: Missing.

Show »
Length:228
Mass (Da):25,981
Checksum:i62C0CD188B3BB448
GO
Isoform 7 (identifier: Q9DCB4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-371: SVCSQESLFL...STDSDSSNRN → VSSCFNCLLS...MCPPGHHLPG
     372-807: Missing.

Show »
Length:371
Mass (Da):43,129
Checksum:i1CE509029F34B491
GO
Isoform 8 (identifier: Q9DCB4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-248: PEQRFCEHLKDEKSEESQKR → VQDTGWRCKHAHRTGAVCTN
     249-807: Missing.

Show »
Length:248
Mass (Da):28,185
Checksum:i68EA58E94344458F
GO
Isoform 9 (identifier: Q9DCB4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: I → M
     229-330: Missing.
     674-703: YQPVLSGQQGFQGMMGVQQSAHSQGVMSSQ → LMIAPDTWPTVPAELALQKVTLLWISEGRW
     704-807: Missing.

Show »
Length:601
Mass (Da):65,217
Checksum:iEF190AAB82D599B1
GO
Isoform 10 (identifier: Q9DCB4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-282: PEQRFCEHLK...DRRSKSIEER → QFAPRKAYFW...AQIRTVPTAI
     283-807: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:282
Mass (Da):31,566
Checksum:i751A0466F6DE3F23
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4A0E9Q4A0_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21 Pnpla2
601Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CYU3E0CYU3_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21
278Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CZ08E0CZ08_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21
282Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CXW0E0CXW0_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CYS3E0CYS3_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CY19E0CY19_MOUSE
cAMP-regulated phosphoprotein 21
Arpp21
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti263N → NQ in BAC26463 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02947787 – 88ES → TL in isoform 2. 2 Publications2
Alternative sequenceiVSP_02947889 – 807Missing in isoform 2. 2 PublicationsAdd BLAST719
Alternative sequenceiVSP_029479228I → M in isoform 6 and isoform 9. 1 Publication1
Alternative sequenceiVSP_029480229 – 807Missing in isoform 6. 1 PublicationAdd BLAST579
Alternative sequenceiVSP_029481229 – 330Missing in isoform 9. 1 PublicationAdd BLAST102
Alternative sequenceiVSP_029482229 – 282PEQRF…SIEER → QFAPRKAYFWTTGLTETAQE ELPGAGRAAQRLSSGGQTTS GLGAAQIRTVPTAI in isoform 10. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_029483229 – 248PEQRF…ESQKR → VQDTGWRCKHAHRTGAVCTN in isoform 8. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_029484249 – 807Missing in isoform 8. 1 PublicationAdd BLAST559
Alternative sequenceiVSP_029485265 – 297Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_029486283 – 807Missing in isoform 10. 1 PublicationAdd BLAST525
Alternative sequenceiVSP_029487298 – 371SVCSQ…SSNRN → VSSCFNCLLSMVLPSAERPL VARTEIWQGVQRLGARNELQ SRKHKCFWERTWFRDALKQS KSLCMCPPGHHLPG in isoform 7. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_029488310 – 329Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_029489372 – 807Missing in isoform 7. 1 PublicationAdd BLAST436
Alternative sequenceiVSP_029490543Q → QSVQSLQPSSQSVQYPAVSF PPQHLLPMSPTQHFPL in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_029491674 – 703YQPVL…VMSSQ → LMIAPDTWPTVPAELALQKV TLLWISEGRW in isoform 9. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_029492704 – 807Missing in isoform 9. 1 PublicationAdd BLAST104

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF324451 mRNA Translation: AAK48713.1
AK002950 mRNA No translation available.
AK029467 mRNA Translation: BAC26463.1
AK032417 mRNA Translation: BAC27859.1
AK032543 mRNA Translation: BAC27918.1
AK045507 mRNA Translation: BAC32399.1
AK050613 mRNA Translation: BAC34343.1
AK137974 mRNA Translation: BAE23526.1
BC027107 mRNA Translation: AAH27107.1
BC053001 mRNA Translation: AAH53001.1
BC128376 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS23587.1 [Q9DCB4-1]
CCDS40786.1 [Q9DCB4-2]
CCDS52943.1 [Q9DCB4-9]
CCDS52944.1 [Q9DCB4-4]
CCDS52945.1 [Q9DCB4-3]
CCDS52946.1 [Q9DCB4-8]

NCBI Reference Sequences

More...
RefSeqi
NP_001171086.1, NM_001177615.1 [Q9DCB4-2]
NP_001171087.1, NM_001177616.1 [Q9DCB4-4]
NP_001171088.1, NM_001177617.1
NP_001171089.1, NM_001177618.1 [Q9DCB4-3]
NP_001171090.1, NM_001177619.1
NP_001171091.1, NM_001177620.1 [Q9DCB4-2]
NP_001171094.1, NM_001177623.1 [Q9DCB4-8]
NP_083031.1, NM_028755.3 [Q9DCB4-2]
NP_150289.1, NM_033264.2 [Q9DCB4-1]
XP_006512407.1, XM_006512344.3 [Q9DCB4-3]
XP_006512411.1, XM_006512348.3 [Q9DCB4-1]
XP_006512413.1, XM_006512350.3 [Q9DCB4-4]
XP_006512414.1, XM_006512351.3 [Q9DCB4-5]
XP_006512424.1, XM_006512361.3
XP_006512425.1, XM_006512362.3
XP_017169139.1, XM_017313650.1 [Q9DCB4-3]
XP_017169140.1, XM_017313651.1
XP_017169141.1, XM_017313652.1
XP_017169142.1, XM_017313653.1
XP_017169146.1, XM_017313657.1
XP_017169148.1, XM_017313659.1
XP_017169149.1, XM_017313660.1
XP_017169152.1, XM_017313663.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000035085; ENSMUSP00000035085; ENSMUSG00000032503 [Q9DCB4-4]
ENSMUST00000070218; ENSMUSP00000069264; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000111872; ENSMUSP00000107503; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000161412; ENSMUSP00000125282; ENSMUSG00000032503 [Q9DCB4-8]
ENSMUST00000162065; ENSMUSP00000125684; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000162097; ENSMUSP00000124502; ENSMUSG00000032503 [Q9DCB4-1]
ENSMUST00000164754; ENSMUSP00000125862; ENSMUSG00000032503 [Q9DCB4-1]
ENSMUST00000172380; ENSMUSP00000130558; ENSMUSG00000032503 [Q9DCB4-2]
ENSMUST00000178410; ENSMUSP00000136769; ENSMUSG00000032503 [Q9DCB4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
74100

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:74100

UCSC genome browser

More...
UCSCi
uc009rvx.2, mouse [Q9DCB4-3]
uc009rvy.2, mouse [Q9DCB4-5]
uc009rvz.2, mouse [Q9DCB4-1]
uc009rwa.2, mouse [Q9DCB4-4]
uc009rwc.2, mouse [Q9DCB4-7]
uc009rwe.2, mouse [Q9DCB4-8]
uc009rwf.1, mouse [Q9DCB4-6]
uc009rwg.2, mouse [Q9DCB4-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF324451 mRNA Translation: AAK48713.1
AK002950 mRNA No translation available.
AK029467 mRNA Translation: BAC26463.1
AK032417 mRNA Translation: BAC27859.1
AK032543 mRNA Translation: BAC27918.1
AK045507 mRNA Translation: BAC32399.1
AK050613 mRNA Translation: BAC34343.1
AK137974 mRNA Translation: BAE23526.1
BC027107 mRNA Translation: AAH27107.1
BC053001 mRNA Translation: AAH53001.1
BC128376 mRNA No translation available.
CCDSiCCDS23587.1 [Q9DCB4-1]
CCDS40786.1 [Q9DCB4-2]
CCDS52943.1 [Q9DCB4-9]
CCDS52944.1 [Q9DCB4-4]
CCDS52945.1 [Q9DCB4-3]
CCDS52946.1 [Q9DCB4-8]
RefSeqiNP_001171086.1, NM_001177615.1 [Q9DCB4-2]
NP_001171087.1, NM_001177616.1 [Q9DCB4-4]
NP_001171088.1, NM_001177617.1
NP_001171089.1, NM_001177618.1 [Q9DCB4-3]
NP_001171090.1, NM_001177619.1
NP_001171091.1, NM_001177620.1 [Q9DCB4-2]
NP_001171094.1, NM_001177623.1 [Q9DCB4-8]
NP_083031.1, NM_028755.3 [Q9DCB4-2]
NP_150289.1, NM_033264.2 [Q9DCB4-1]
XP_006512407.1, XM_006512344.3 [Q9DCB4-3]
XP_006512411.1, XM_006512348.3 [Q9DCB4-1]
XP_006512413.1, XM_006512350.3 [Q9DCB4-4]
XP_006512414.1, XM_006512351.3 [Q9DCB4-5]
XP_006512424.1, XM_006512361.3
XP_006512425.1, XM_006512362.3
XP_017169139.1, XM_017313650.1 [Q9DCB4-3]
XP_017169140.1, XM_017313651.1
XP_017169141.1, XM_017313652.1
XP_017169142.1, XM_017313653.1
XP_017169146.1, XM_017313657.1
XP_017169148.1, XM_017313659.1
XP_017169149.1, XM_017313660.1
XP_017169152.1, XM_017313663.1

3D structure databases

SMRiQ9DCB4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi216492, 1 interactor

PTM databases

iPTMnetiQ9DCB4
PhosphoSitePlusiQ9DCB4

Proteomic databases

jPOSTiQ9DCB4
PeptideAtlasiQ9DCB4
PRIDEiQ9DCB4
ProteomicsDBi283233 [Q9DCB4-1]
283234 [Q9DCB4-2]
283235 [Q9DCB4-3]
283236 [Q9DCB4-4]
283237 [Q9DCB4-5]
283238 [Q9DCB4-6]
283239 [Q9DCB4-7]
283240 [Q9DCB4-8]
283241 [Q9DCB4-9]
283242 [Q9DCB4-10]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2806, 158 antibodies

Genome annotation databases

EnsembliENSMUST00000035085; ENSMUSP00000035085; ENSMUSG00000032503 [Q9DCB4-4]
ENSMUST00000070218; ENSMUSP00000069264; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000111872; ENSMUSP00000107503; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000161412; ENSMUSP00000125282; ENSMUSG00000032503 [Q9DCB4-8]
ENSMUST00000162065; ENSMUSP00000125684; ENSMUSG00000032503 [Q9DCB4-3]
ENSMUST00000162097; ENSMUSP00000124502; ENSMUSG00000032503 [Q9DCB4-1]
ENSMUST00000164754; ENSMUSP00000125862; ENSMUSG00000032503 [Q9DCB4-1]
ENSMUST00000172380; ENSMUSP00000130558; ENSMUSG00000032503 [Q9DCB4-2]
ENSMUST00000178410; ENSMUSP00000136769; ENSMUSG00000032503 [Q9DCB4-2]
GeneIDi74100
KEGGimmu:74100
UCSCiuc009rvx.2, mouse [Q9DCB4-3]
uc009rvy.2, mouse [Q9DCB4-5]
uc009rvz.2, mouse [Q9DCB4-1]
uc009rwa.2, mouse [Q9DCB4-4]
uc009rwc.2, mouse [Q9DCB4-7]
uc009rwe.2, mouse [Q9DCB4-8]
uc009rwf.1, mouse [Q9DCB4-6]
uc009rwg.2, mouse [Q9DCB4-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10777
MGIiMGI:107562, Arpp21

Phylogenomic databases

GeneTreeiENSGT00940000160796
HOGENOMiCLU_007817_1_0_1
InParanoidiQ9DCB4
OMAiANCRTNC
OrthoDBi137913at2759
PhylomeDBiQ9DCB4
TreeFamiTF315915

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
74100, 0 hits in 50 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Arpp21, mouse

Protein Ontology

More...
PROi
PR:Q9DCB4
RNActiQ9DCB4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000032503, Expressed in caudate-putamen and 210 other tissues
ExpressionAtlasiQ9DCB4, baseline and differential
GenevisibleiQ9DCB4, MM

Family and domain databases

Gene3Di3.30.1370.50, 1 hit
InterProiView protein in InterPro
IPR001374, R3H_dom
IPR036867, R3H_dom_sf
IPR024771, SUZ
PfamiView protein in Pfam
PF01424, R3H, 1 hit
PF12752, SUZ, 1 hit
SMARTiView protein in SMART
SM00393, R3H, 1 hit
SUPFAMiSSF82708, SSF82708, 1 hit
PROSITEiView protein in PROSITE
PS51061, R3H, 1 hit
PS51673, SUZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARP21_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9DCB4
Secondary accession number(s): A1A561
, Q3UUU8, Q7TS83, Q8BLD1, Q8BWM1, Q8C018, Q8C038, Q8C0Y6, Q91Y59
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 13, 2007
Last modified: April 7, 2021
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again