Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9DC33 (HM20A_MOUSE)

Entry version 139 (22 Apr 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

High mobility group protein 20A

Gene

Hmg20a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi102 – 170HMG boxPROSITE-ProRule annotationAdd BLAST69

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
High mobility group protein 20A
Alternative name(s):
HMG box-containing protein 20A
HMG domain-containing protein HMGX1
Inhibitor of BRAF35
Short name:
iBRAF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Hmg20a
Synonyms:Ibraf
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1914117 Hmg20a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002386501 – 346High mobility group protein 20AAdd BLAST346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei104PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9DC33

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9DC33

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9DC33

PeptideAtlas

More...PeptideAtlasi		Q9DC33

PRoteomics IDEntifications database

More...PRIDEi		Q9DC33

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9DC33

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9DC33

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain. Detected in mature neurons.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Detected at 16.5 dpc in the outer cortex of the developing brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000032329 Expressed in dorsal pancreas and 292 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9DC33 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9DC33 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		211774, 5 interactors

Protein interaction database and analysis system

More...IntActi		Q9DC33, 2 interactors

Molecular INTeraction database

More...MINTi		Q9DC33

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000034879

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9DC33 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9DC33

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili228 – 272Sequence analysisAdd BLAST45

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0381 Eukaryota
COG5648 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158464

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_060006_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9DC33

Identification of Orthologs from Complete Genome Data

More...OMAi		NSQRNGD

Database of Orthologous Groups

More...OrthoDBi		1458939at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9DC33

TreeFam database of animal gene trees

More...TreeFami		TF106440

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009071 HMG_box_dom
IPR036910 HMG_box_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00505 HMG_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00398 HMG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47095 SSF47095, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50118 HMG_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9DC33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESLMASSTL PPLFADEDGS KESNDLATSG LTHPEGPYGS AATSTTNPEF 
        60         70         80         90        100
VEDLSQGQLL QSEASNAVEG NEQRPEDEQR SKRGGWSKGR KRKKPLRDSN 
       110        120        130        140        150
APKSPLTGYV RFMNERREQL RAKRPEVPFP EITRMLGNEW SKLPPEEKQR 
       160        170        180        190        200
YLDEADRDKE RYMKELEQYQ KTEAYKVFSR KTQDRQKGKS HRQDAARQAT 
       210        220        230        240        250
HDHEKETEVK ERSVFDIPIF TEEFLNHSKA REAELRQLRK SNMEFEERNA 
       260        270        280        290        300
ALQKHVESMR TAVEKLEVDV IQERSRNTVL QQHLETLRQM LTSSFASMPL 
       310        320        330        340 
PGSGEIPTVD TIDSYMNRLH SIILANPQDN ENFIATVREV VNRLDR
Length:346
Mass (Da):39,917
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD57502BEFD3C0026
GO
Isoform 2 (identifier: Q9DC33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-346: SGEIPTVDTI...VREVVNRLDR → NVILSEVSGR...SVSSRPACPT

Show »
Length:379
Mass (Da):43,335
Checksum:i3053980DC8BA7DE7
GO
Isoform 3 (identifier: Q9DC33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-180: RYLDEADRDKERYMKELEQYQKTEAYKVFSR → VMVPASGVSLGFDYISQIVWGAGEIWGLGHA
     181-346: Missing.

Show »
Length:180
Mass (Da):19,843
Checksum:iE176D4DD46271E60
GO
Isoform 4 (identifier: Q9DC33-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-101: QRSKRGGWSKGRKRKKPLRDSNA → VSEHLLSLSTAASKAMGMQGGIE
     102-346: Missing.

Show »
Length:101
Mass (Da):10,514
Checksum:iAB97522B12E4508E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SRA5A0A1L1SRA5_MOUSE
High mobility group protein 20A
Hmg20a
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1L1SSI9A0A1L1SSI9_MOUSE
High mobility group protein 20A
Hmg20a
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABA26278 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti294S → C in BAC30283 (PubMed:16141072).Curated1
Sequence conflicti301P → T in BAB30892 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01862379 – 101QRSKR…RDSNA → VSEHLLSLSTAASKAMGMQG GIE in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_018624102 – 346Missing in isoform 4. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_018625150 – 180RYLDE…KVFSR → VMVPASGVSLGFDYISQIVW GAGEIWGLGHA in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_018626181 – 346Missing in isoform 3. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_018627303 – 346SGEIP…NRLDR → NVILSEVSGRESGEDGDGVL FTLVLMWRSRSVSQEEKRRG KKNPVKIFSAVWACLKSQHS GGRGRKISVSSRPACPT in isoform 2. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
DQ182735 mRNA Translation: ABA26278.1 Different initiation.
AK004596 mRNA Translation: BAB23397.1
AK017716 mRNA Translation: BAB30892.1
AK032790 mRNA Translation: BAC28023.1
AK039222 mRNA Translation: BAC30283.1
AK086346 mRNA Translation: BAC39652.1
AK134213 mRNA Translation: BAE22054.1
BC013804 mRNA Translation: AAH13804.1
BC068257 mRNA Translation: AAH68257.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS23208.1 [Q9DC33-1]

NCBI Reference Sequences

More...RefSeqi		NP_080088.1, NM_025812.2 [Q9DC33-1]
XP_006511431.1, XM_006511368.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000034879; ENSMUSP00000034879; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000214869; ENSMUSP00000150382; ENSMUSG00000032329 [Q9DC33-4]
ENSMUST00000215269; ENSMUSP00000149698; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000217518; ENSMUSP00000149359; ENSMUSG00000032329 [Q9DC33-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		66867

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:66867

UCSC genome browser

More...UCSCi		uc009ptb.1 mouse [Q9DC33-4]
uc009ptc.1 mouse [Q9DC33-3]
uc009ptd.1 mouse [Q9DC33-2]
uc009pte.1 mouse [Q9DC33-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ182735 mRNA Translation: ABA26278.1 Different initiation.
AK004596 mRNA Translation: BAB23397.1
AK017716 mRNA Translation: BAB30892.1
AK032790 mRNA Translation: BAC28023.1
AK039222 mRNA Translation: BAC30283.1
AK086346 mRNA Translation: BAC39652.1
AK134213 mRNA Translation: BAE22054.1
BC013804 mRNA Translation: AAH13804.1
BC068257 mRNA Translation: AAH68257.1
CCDSiCCDS23208.1 [Q9DC33-1]
RefSeqiNP_080088.1, NM_025812.2 [Q9DC33-1]
XP_006511431.1, XM_006511368.2

3D structure databases

SMRiQ9DC33
ModBaseiSearch...

Protein-protein interaction databases

BioGridi211774, 5 interactors
IntActiQ9DC33, 2 interactors
MINTiQ9DC33
STRINGi10090.ENSMUSP00000034879

PTM databases

iPTMnetiQ9DC33
PhosphoSitePlusiQ9DC33

Proteomic databases

EPDiQ9DC33
jPOSTiQ9DC33
PaxDbiQ9DC33
PeptideAtlasiQ9DC33
PRIDEiQ9DC33

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1449 289 antibodies

Genome annotation databases

EnsembliENSMUST00000034879; ENSMUSP00000034879; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000214869; ENSMUSP00000150382; ENSMUSG00000032329 [Q9DC33-4]
ENSMUST00000215269; ENSMUSP00000149698; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000217518; ENSMUSP00000149359; ENSMUSG00000032329 [Q9DC33-2]
GeneIDi66867
KEGGimmu:66867
UCSCiuc009ptb.1 mouse [Q9DC33-4]
uc009ptc.1 mouse [Q9DC33-3]
uc009ptd.1 mouse [Q9DC33-2]
uc009pte.1 mouse [Q9DC33-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10363
MGIiMGI:1914117 Hmg20a

Phylogenomic databases

eggNOGiKOG0381 Eukaryota
COG5648 LUCA
GeneTreeiENSGT00940000158464
HOGENOMiCLU_060006_0_0_1
InParanoidiQ9DC33
OMAiNSQRNGD
OrthoDBi1458939at2759
PhylomeDBiQ9DC33
TreeFamiTF106440

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Hmg20a mouse

Protein Ontology

More...PROi		PR:Q9DC33
RNActiQ9DC33 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000032329 Expressed in dorsal pancreas and 292 other tissues
ExpressionAtlasiQ9DC33 baseline and differential
GenevisibleiQ9DC33 MM

Family and domain databases

Gene3Di1.10.30.10, 1 hit
InterProiView protein in InterPro
IPR009071 HMG_box_dom
IPR036910 HMG_box_dom_sf
PfamiView protein in Pfam
PF00505 HMG_box, 1 hit
SMARTiView protein in SMART
SM00398 HMG, 1 hit
SUPFAMiSSF47095 SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118 HMG_BOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHM20A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9DC33
Secondary accession number(s): Q3LSF9
, Q6NV87, Q8BSK1, Q8C3C1, Q8CAA0, Q9CYG2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: April 22, 2020
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again