Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High mobility group protein 20A

Gene

Hmg20a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi102 – 170HMG boxPROSITE-ProRule annotationAdd BLAST69

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • identical protein binding Source: MGI
  • protein heterodimerization activity Source: MGI

GO - Biological processi

  • chromatin organization Source: UniProtKB-KW
  • negative regulation of neuron differentiation Source: MGI
  • negative regulation of protein sumoylation Source: MGI
  • negative regulation of transcription by RNA polymerase II Source: MGI
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionChromatin regulator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
High mobility group protein 20A
Alternative name(s):
HMG box-containing protein 20A
HMG domain-containing protein HMGX1
Inhibitor of BRAF35
Short name:
iBRAF
Gene namesi
Name:Hmg20a
Synonyms:Ibraf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1914117 Hmg20a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002386501 – 346High mobility group protein 20AAdd BLAST346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei104PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9DC33
PaxDbiQ9DC33
PeptideAtlasiQ9DC33
PRIDEiQ9DC33

PTM databases

iPTMnetiQ9DC33
PhosphoSitePlusiQ9DC33

Expressioni

Tissue specificityi

Expressed in brain. Detected in mature neurons.1 Publication

Developmental stagei

Detected at E16.5 in the outer cortex of the developing brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000032329
CleanExiMM_HMG20A
ExpressionAtlasiQ9DC33 baseline and differential
GenevisibleiQ9DC33 MM

Interactioni

GO - Molecular functioni

  • identical protein binding Source: MGI
  • protein heterodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi211774, 3 interactors
IntActiQ9DC33, 2 interactors
MINTiQ9DC33
STRINGi10090.ENSMUSP00000034879

Structurei

3D structure databases

ProteinModelPortaliQ9DC33
SMRiQ9DC33
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili228 – 272Sequence analysisAdd BLAST45

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0381 Eukaryota
COG5648 LUCA
GeneTreeiENSGT00730000110938
HOVERGENiHBG059870
InParanoidiQ9DC33
OMAiSYMKKLH
OrthoDBiEOG091G0IHZ
PhylomeDBiQ9DC33
TreeFamiTF106440

Family and domain databases

Gene3Di1.10.30.10, 1 hit
InterProiView protein in InterPro
IPR009071 HMG_box_dom
IPR036910 HMG_box_dom_sf
PfamiView protein in Pfam
PF00505 HMG_box, 1 hit
SMARTiView protein in SMART
SM00398 HMG, 1 hit
SUPFAMiSSF47095 SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118 HMG_BOX_2, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DC33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESLMASSTL PPLFADEDGS KESNDLATSG LTHPEGPYGS AATSTTNPEF
60 70 80 90 100
VEDLSQGQLL QSEASNAVEG NEQRPEDEQR SKRGGWSKGR KRKKPLRDSN
110 120 130 140 150
APKSPLTGYV RFMNERREQL RAKRPEVPFP EITRMLGNEW SKLPPEEKQR
160 170 180 190 200
YLDEADRDKE RYMKELEQYQ KTEAYKVFSR KTQDRQKGKS HRQDAARQAT
210 220 230 240 250
HDHEKETEVK ERSVFDIPIF TEEFLNHSKA REAELRQLRK SNMEFEERNA
260 270 280 290 300
ALQKHVESMR TAVEKLEVDV IQERSRNTVL QQHLETLRQM LTSSFASMPL
310 320 330 340
PGSGEIPTVD TIDSYMNRLH SIILANPQDN ENFIATVREV VNRLDR
Length:346
Mass (Da):39,917
Last modified:June 1, 2001 - v1
Checksum:iD57502BEFD3C0026
GO
Isoform 2 (identifier: Q9DC33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-346: SGEIPTVDTI...VREVVNRLDR → NVILSEVSGR...SVSSRPACPT

Show »
Length:379
Mass (Da):43,335
Checksum:i3053980DC8BA7DE7
GO
Isoform 3 (identifier: Q9DC33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-180: RYLDEADRDKERYMKELEQYQKTEAYKVFSR → VMVPASGVSLGFDYISQIVWGAGEIWGLGHA
     181-346: Missing.

Show »
Length:180
Mass (Da):19,843
Checksum:iE176D4DD46271E60
GO
Isoform 4 (identifier: Q9DC33-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-101: QRSKRGGWSKGRKRKKPLRDSNA → VSEHLLSLSTAASKAMGMQGGIE
     102-346: Missing.

Show »
Length:101
Mass (Da):10,514
Checksum:iAB97522B12E4508E
GO

Sequence cautioni

The sequence ABA26278 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti294S → C in BAC30283 (PubMed:16141072).Curated1
Sequence conflicti301P → T in BAB30892 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01862379 – 101QRSKR…RDSNA → VSEHLLSLSTAASKAMGMQG GIE in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_018624102 – 346Missing in isoform 4. 1 PublicationAdd BLAST245
Alternative sequenceiVSP_018625150 – 180RYLDE…KVFSR → VMVPASGVSLGFDYISQIVW GAGEIWGLGHA in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_018626181 – 346Missing in isoform 3. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_018627303 – 346SGEIP…NRLDR → NVILSEVSGRESGEDGDGVL FTLVLMWRSRSVSQEEKRRG KKNPVKIFSAVWACLKSQHS GGRGRKISVSSRPACPT in isoform 2. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ182735 mRNA Translation: ABA26278.1 Different initiation.
AK004596 mRNA Translation: BAB23397.1
AK017716 mRNA Translation: BAB30892.1
AK032790 mRNA Translation: BAC28023.1
AK039222 mRNA Translation: BAC30283.1
AK086346 mRNA Translation: BAC39652.1
AK134213 mRNA Translation: BAE22054.1
BC013804 mRNA Translation: AAH13804.1
BC068257 mRNA Translation: AAH68257.1
CCDSiCCDS23208.1 [Q9DC33-1]
RefSeqiNP_080088.1, NM_025812.2 [Q9DC33-1]
XP_006511431.1, XM_006511368.2 [Q9DC33-2]
UniGeneiMm.150856

Genome annotation databases

EnsembliENSMUST00000034879; ENSMUSP00000034879; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000214869; ENSMUSP00000150382; ENSMUSG00000032329 [Q9DC33-4]
ENSMUST00000215269; ENSMUSP00000149698; ENSMUSG00000032329 [Q9DC33-1]
ENSMUST00000217518; ENSMUSP00000149359; ENSMUSG00000032329 [Q9DC33-2]
GeneIDi66867
KEGGimmu:66867
UCSCiuc009ptb.1 mouse [Q9DC33-4]
uc009ptc.1 mouse [Q9DC33-3]
uc009ptd.1 mouse [Q9DC33-2]
uc009pte.1 mouse [Q9DC33-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHM20A_MOUSE
AccessioniPrimary (citable) accession number: Q9DC33
Secondary accession number(s): Q3LSF9
, Q6NV87, Q8BSK1, Q8C3C1, Q8CAA0, Q9CYG2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: April 25, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health